SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Apimo1|113103|gm1.10791_g from Apiospora montagnei NRRL 25634 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Apimo1|113103|gm1.10791_g
Domain Number - Region: 47-160
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00011
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number - Region: 170-205
Classification Level Classification E-value
Superfamily BLRF2-like 0.00262
Family BLRF2-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Apimo1|113103|gm1.10791_g
Sequence length 206
Sequence
MSERTSLLVRFPESGSLVRGFTSDWRSTYRKARRETQRFLSSKAKHWVILALVVLDVAGI
LSDIFIALITCELKMEDEAWVQPTRGALTTFSLVMSCLFLLELLLCLWAEGIRYLSNWFH
CFDAFVIVGSFVIDLLEHGIAEEIASLIVILRLWRFVKIVNELSVEASEQIEEIQRRLEE
LEKENGELRRQLGQNRRQGDEEEALS
Download sequence
Identical sequences jgi|Apimo1|113103|gm1.10791_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]