SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Apimo1|121869|estExt_Genemark1.C_490037 from Apiospora montagnei NRRL 25634 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Apimo1|121869|estExt_Genemark1.C_490037
Domain Number 1 Region: 410-587
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.36e-22
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.012
Further Details:      
 
Domain Number 2 Region: 304-402
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000000981
Family Rhamnogalacturonase B, RhgB, middle domain 0.066
Further Details:      
 
Domain Number 3 Region: 115-284
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.0000144
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Apimo1|121869|estExt_Genemark1.C_490037
Sequence length 588
Sequence
MRIASVATALALLLSSSRAHTLPPRATSGPFLQELGNETWVIGNEIWNMTQGRQYGVQLF
YRDHNCVGDAVGHYVSYNGAQSDLNWTAASIEKEGAHNGAAYLDVKFTAREGDMHWVIFS
GLAGAYQYFVNRDLPVLGEFRTLWRLDNATFTHGKTDLRDEALPPLSDYRPENKVQDETW
LKPDGSGGYLTKYDLSSWIRTQSYYGVYGERFGSWYINAGKDYYNGNHLKQELMIHRESK
TGDAVQLNMIHGTHFQVSAVDEFPEGKMWGPWLWYLNDGSREDAAQRAVDEFAAWPYAWL
EDEAYQQRGSVRGQLQLSDGRPAAHAAVFLGDNGGNKTALDMGSDYYYTDYADAEGRFEF
RDVRAATYGLQAWSNGSKIADVTTEYHHKDVVVTAGEMLNLETATWQVSDKTKIFQVGDF
DRTSYGFAHGGAPYEHGLVEKCPASLNFTVGVSQTEDWCFGQSKLGSWVISFSLDKSPAP
CPKRRVDKPSKSREATLIVSLAGYSTGASSRIWANDVVIGNLTSGAAPGLLNDPSLYRSG
TTAGEWRYFEFPFDAGTILKKGLNEIRFEVTSNTTWRGFMWDSIVLEW
Download sequence
Identical sequences jgi|Apimo1|121869|estExt_Genemark1.C_490037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]