SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Apimo1|172591|e_gw1.59.89.1 from Apiospora montagnei NRRL 25634 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Apimo1|172591|e_gw1.59.89.1
Domain Number - Region: 28-137
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0306
Family Voltage-gated potassium channels 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Apimo1|172591|e_gw1.59.89.1
Sequence length 758
Sequence
MRSQDSFLARRPGLTSALNGVRSYLPPLNYITLHYAYFIVVCLIFSLVHWGASNPKYSIS
YVDSLFLVVSAMTEAGLNTVNLSEMTTFQQVLLCLLIMLGSSVWVSIWTVLARKHAFETR
FEDIVRRERARAKSAERRDGLALNMPIMQKLSRTFRKSKTLPDNSTQSATSSGLTRQNPD
TGSISVLPISSPVAVEKLSEPVPMSHAERARSEGQDAADSPPNSSPTNNDHIAFVDDVEA
SRPKTTSSAYEPGRGIVRRHVPGSRDDGTIREDSGTEMNHQQYLTSQKIGRNAQFHDLTA
EERDNLGGTEYRALKVLSWVVPAYFFLWQILGCIALGAYINNNIPGPANANAINPWWNGI
FNGISAFNNSGMSVLDANMIPYGSSYFVLIVMGAMILAGNTAYPVFLRFWLWSMLKSLEL
LTYEDSYRDLKSTLQYILKYPRRVYTNLFPARATWWLLFMLFVLNGTDWVAFEVLNLGNA
SLAHIPIGSRIIDGLFQALAVRSGGFYVVNIPGLYIGLQVLYVIMMYISVYPVVITMRHS
NVYEERSLGLYAEDVEAASMTSTMSSIAPQNSNTSRKRRGSTSAGLFNRALRRALGEWQG
VGAARQQPTGLDDTAESRTNFISHQVRGQLSHDLWLLVVAVLFIMIIETSHFLGDPVTYS
VFNVIFEVTSAYGCVGISTGIPNAAYSFSGGMYTGSKLILVLVMLRGRHRGLPVALDRAV
RLPGDELEREEEEDHRIRRSISQRRPSSVGDVSMRGAV
Download sequence
Identical sequences jgi|Apimo1|172591|e_gw1.59.89.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]