SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Apimo1|173962|e_gw1.68.126.1 from Apiospora montagnei NRRL 25634 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Apimo1|173962|e_gw1.68.126.1
Domain Number 1 Region: 1160-1320,1359-1436
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.3e-19
Family Voltage-gated potassium channels 0.018
Further Details:      
 
Domain Number 2 Region: 309-372,447-545,623-689
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000000157
Family Voltage-gated potassium channels 0.014
Further Details:      
 
Domain Number 3 Region: 738-957
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000314
Family Voltage-gated potassium channels 0.023
Further Details:      
 
Domain Number 4 Region: 1489-1730
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000149
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Weak hits

Sequence:  jgi|Apimo1|173962|e_gw1.68.126.1
Domain Number - Region: 1736-1785
Classification Level Classification E-value
Superfamily EF-hand 0.000521
Family Calmodulin-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Apimo1|173962|e_gw1.68.126.1
Sequence length 2081
Sequence
MQRNSDLPGLSTYWGQSQGAQQESDAHPAGHVGSTPSSPIDPAALQFALPPEIHPPHPSP
GHPSPGHPSPGHPSPGQPTLGQPSPSSLNPYAMQTSYYDEPSNGDYFDSDRAPLTSGAQP
ISGALATPPTEAHPRSSFQTVSDLDGAQSPKPRDTKMLGFDLGPDFESSKHRSFGDSLTP
TDHRLSRSPGTALYRAGSIVRAMSQRVVNISGETETLEQQQQRRSRSRSPSADGRRSQLP
SDFGGDTSYQSQVYPTTPLEKAGDRFTFAPEPPMAPSRPMPNPLKGRSLGVFSPDNPIRK
RLCDVLVNPYMEPFILILIVLQTILLAVEAAPNVHEEGNHRPLKWGGNTIDWAMLVLFAI
FTVELIARIIVSGFVLNATEYSTIDRGKGVRKVVAERYEAVFKPQRQKSVKSPREDSFGP
HTFARSFTMMHGQRLPETVEEAQRMQLARRAFLRHGFNRLDFVAVVSFWITFALSITGLE
AEHHVWIFRMLSCLRIVRLLALTNGTSIILRSLKKATPLLLRVSFLILFFWILFAIIGIQ
SFKTSLSRQCVWINPEDPENVTAAYTNSEVFCGGYLALNGTPQPWVKMRNDNLSDLQPVP
THAKGYICPKGSLCLLQESPYNNTVNFDNIYHSLELVFVLMSANTWSDLMYWTTNSDYLT
SALFFGAGIMIMMLWMTNLLIAVITSSFQVIREESKSSAFTSSQDPFLAAAPDQDRLQRT
STLQKLYDKTSIIWVLIITFDLLTQAWRSSRMPESRALFIHVVEIIVTSLLDIEIAIRIA
ANWRGFHRNSRNLFDLFLAVATTIIILPPIFNSGQTYAWLTAFQILRIYRVVLAIPITRK
LILLVLGNAAGIANLMLFVFLITFIMAIFAVQLFRGELPMYEDGELNRISFYNIYNAFLG
MYQILSSENWTEILYHVTSYTTDKRTSWYGSMFLIGWFILAFFILVNMFIAVIQENFDVS
EDEKRLEQVKAFLQRKELGNNQSNLALSTIFTFGKTRRKKDPLDYGPATMEMLLKDAVVR
EFLDDSMDPLQQTSTDGQASHHGAGAGDVRPGLLSGIWGRLRGVFISKDPNPFYSNIRFN
GPNDTLDPRQMAREAVSATSARRKAQREYLARHPTYNDSLYIFTPKNPFRRMCQRLVGPG
RGNERFDGVEPNKIAWYTFSAFIYAAIVAMVILACVTTPLYQKEYFMTHDFKFTNWFVWV
DLGFAVVFSVEAVIKIVADGLFFTPNAYFRSSWGLIDAVVLITLWINVITLLAQDGAVSR
AVGAFKALRALRLLNISDTARETFHSLVIASIWKILGAAFVSISLLIPFAIYALNLFNGL
LVNCNDGDVANLSECFGEYEASPFNDDWPMLAPRLADNPFYSFDDFGSSLFILFQIVSQE
GWTDVSFSVQAITGRGEQPSDLAAPGNAMFLVIFNILATVFVLTLFISIFMRNYTEQTGV
AFLTAEQRAWLELRKLLRQISPSKSSYDDSEKKWKKWCHKRAIEKRGKWYTAITGVLVFH
LILLMAEFEPEPAWWTRTRDILFLAFTFTYIANIVIRIVGLGWARFRRSSWDMFSLITVT
GALATSFLLETNRTHDTYNQLHKFFLVAIVLLLIPRNDALDQLFKTAAASLTTIVNLLAT
WLVFFLVFAIAFTQTFSLTKFGGGQNANLNFRTVPKALIMLFRMSTGEGWNEIMEDFATI
EPPFCVDTRDFFTSDCGSTAWARGLFIGWNIVSMYLFVNLFISLIYESFSYVYQRSSGLP
SVDRDEIRRFKEAWRSVDPAGTGFISKEQFPRLLGELSGIFTMRIYDQEDSVRSILEDVR
NEASQARHTSIASGAASTSTWGVDIGKLNDRLNKIDVQEVRNRRRRFNVFFEEVMVSADP
DRGISFTTVLMILAHYNIISDSKSLRLEEFLRRRARLQRVEEEVRRRVVLGFFDTLYWAR
KFKRHIAKKKMGRMTAIPQLDVPDIFVEDENQRLHPPQRTTLAATPRRPSQSSEFLGASN
AARPLHNSWNSSVDIGYDNTSAHPLSEPRAAPSMPRHNTQMSAFSFELQEPGTSSAGNSR
RGSSVSPAQVRELLDDSVWVESIRRSATIRKSVRKTDWSAY
Download sequence
Identical sequences jgi|Apimo1|173962|e_gw1.68.126.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]