SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Apimo1|220958|estExt_Genewise1Plus.C_330073 from Apiospora montagnei NRRL 25634 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Apimo1|220958|estExt_Genewise1Plus.C_330073
Domain Number 1 Region: 20-274
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 5.34e-51
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.00024
Further Details:      
 
Domain Number 2 Region: 368-542
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.34e-36
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.0000669
Further Details:      
 
Domain Number 3 Region: 277-356
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000000000687
Family Rhamnogalacturonase B, RhgB, middle domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Apimo1|220958|estExt_Genewise1Plus.C_330073
Sequence length 543
Sequence
MLLLALFYSLLVWPAAVLAGFGWSDDGANYVIDSGADLVIKVSKCCGDIVSMRFKGVEYQ
GYGGKNTQVEIGLGPSTVTIEQMNPVIKVSVTHGTLKHYLVFRYKNNNVYIFTNKQDASV
TVSRYIVRFPANIFPHSPDDADYYDDGSEWIEASDVMKDSRGFTESKHYAGNTYGRTIDY
DYVGKSNGNAGMWMVRSNHEKASGGPFFRSLVRRGSFTGEDLYEIYHYNMGHTDPERFGL
QGPTVLAFTNGEPPSPNLFARRADWGWFDNLGIEGWVPQSGRGRVAGIGLANMKEGYAYV
VGLSNADAQYWATAGSNGAWSITGVLPGTYKLTVYKSELEVHTSSVAVEAGKGAAVHTIT
CADPADVPALWRIGEWDGTPKGFLNFADTPMKPTYMHPADSRLAPWDASNYIVGTSTASI
FPGYMWVDVNNDHVVYFRLRPEQLAAGHRLRIGITEAYIGARPRVRVNGWTSPIPPATNQ
GGTRSLTVGTYRGNNAMLTYDVPASAWIQSASEWQVLTISVVSGSRGSGFLSAGVSFDCL
DLV
Download sequence
Identical sequences jgi|Apimo1|220958|estExt_Genewise1Plus.C_330073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]