SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Apimo1|222542|estExt_Genewise1Plus.C_420154 from Apiospora montagnei NRRL 25634 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Apimo1|222542|estExt_Genewise1Plus.C_420154
Domain Number 1 Region: 400-565
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.02e-24
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.032
Further Details:      
 
Domain Number 2 Region: 292-370
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000000687
Family Rhamnogalacturonase B, RhgB, middle domain 0.014
Further Details:      
 
Domain Number 3 Region: 43-274
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.00000264
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Apimo1|222542|estExt_Genewise1Plus.C_420154
Sequence length 567
Sequence
MRGISLGLIGVFTSLPLVSAIRAPFLEQVDNTTWTFGNDLWNVTQEEVYATKVYFNGTEL
VGSASGHYMGYDGENNFIWTSATITSRGEDYIDVSFACKEGELHWVIFEGLAGAYQYFVN
RNLPNISILRTLWRLDPKLFLNGRTYLRNQPLPDFSLYQNATKVQDETWQFANGTFITKY
DFSDYVRERDFYGIYGPNFGSWYIHPGTDYYNSDHLSQTLTVHRESATGDSVQLNVVQDT
SHFRVGEKVAQPDGKIWGPWLWYLNNGNADNAERQAKEELSKWPYGWLKDPAYQSRGKVT
GVLRLSDGRPASGAAVFLGDKDTARRPSVQGRDYYYTTYADQDGRFSVKDVRSGTYGLYV
WSNGGALTDVYTNFSKSDVKIVTGIITDLHILTWSVPDQGKRLFSIGEFDKKALGFSNGG
PPYQHGVSDQSPANLTFTVGKSRTSDWYYAQALVGTWAVEFDLDHQALARRGNGSSATLS
LSFAGYSQSAAMDVTINGQLLGSLNKDTFASDPSLYRSGKTSGEWRFVQYRIPSDALTGG
ANRLGFTVTRYTQWRGFMWDSIVLEWS
Download sequence
Identical sequences jgi|Apimo1|222542|estExt_Genewise1Plus.C_420154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]