SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Apimo1|245384|CE7645_22346 from Apiospora montagnei NRRL 25634 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Apimo1|245384|CE7645_22346
Domain Number - Region: 291-503
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0549
Family Voltage-gated potassium channels 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Apimo1|245384|CE7645_22346
Sequence length 759
Sequence
MFSEYASRFLAQSQSRLSNFGQTDATGEPSGRQTSDPSSRFSRQPTRSAYHSRLGNPYQP
SSSRFGFGSRYQGGHDAAPLFHSALNEFQDEDEDDLREAADLRALQRSRRVFVSNRIDES
SASENEQSRGSLDRSSERDTRAYEDRDRPMGIKSSWNGDSSFKDFKDRTAKQKRPDDTKS
AGKRKSERANSDSSEGGKMVDVGLESEMLDNEVPEDLLQETPVDADPPPFQKFNPKSGGW
KGSAPGRREPNLEHDPRLMRQTILEEEEPPEETIPGAIEYNNELFKNDQFWAWLYLITIA
SLFATFVLVWLHTSTPSRKNPIGDTVYTVLYKSYYLLAVDTLVAVIVSLVWMAALRSYVR
QLVGIIIIGSPIVLVSFSIYTMVLSFQGPDNGTRFQDRAMRYSALVPGITAFVYVWLMLK
TRDTISRATEMLAFTSRVLSANPALVMLGFCALAFTVGWTWIWLSMFTRVFLGGYFSKSL
SSYVIGAASWWLGVFFALMYLWTIAIASNVVRATVAGTVSNWYFHRNKQPPSPSNAVVGE
ALQHATNSTFGTICAATLLALAIRLPLMVLPNKVARTVGFLLNRYTPASVFLLTNPLVIT
HAAIHTLPLMLSAAQLSRMQFLDSDNPTNTLRPSHLFHLNRYSGGLMPYRLAKFLLHATR
TVVAAGLGFAGWVMTARQLEIQLPQGAGIKGSAYAYIVGLVAGAIGYSILGALEGIMVGI
LDAALICYGSERRMGSGRMGYCMEAANLFGGRNESRDMV
Download sequence
Identical sequences jgi|Apimo1|245384|CE7645_22346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]