SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000012 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000012
Domain Number 1 Region: 36-79
Classification Level Classification E-value
Superfamily TNF receptor-like 1.65e-16
Family BAFF receptor-like 0.00045
Further Details:      
 
Domain Number 2 Region: 4-39
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000141
Family BAFF receptor-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000012   Gene: ENSMPUG00000000012   Transcript: ENSMPUT00000000012
Sequence length 262
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897131.1:369951:416567:-1 gene:ENSMPUG00000000012 transcript:ENSMPUT00000000012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMELCPEEQYWDSLLNICFSCKPICSHQFPRTCAAFCKSLSCRKEEGRYYDQLLKDCIS
CASVCGRHPKQCTYFCENKFRSHVNLPPELKRQRSGEAETRSDDLGRYQGTEHRGSEAGP
GLKLSADQLALVYSTLGLCLCAIVCCFLLAVACFLKRRGDQFSCQPSAAPCRTQAKSSKD
HWMEAGSAAGTPPEPVETCSFCFPERRQPTQESAGASRTPDAAPSGRWARLGPSATAQPC
ARAPDGGLEVLCAPAEEGGPAA
Download sequence
Identical sequences M3XLR2
ENSMPUP00000000012 XP_012903343.1.14098 XP_012903344.1.14098 ENSMPUP00000000012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]