SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000014 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000014
Domain Number 1 Region: 362-459
Classification Level Classification E-value
Superfamily PH domain-like 1.99e-24
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 
Domain Number 2 Region: 18-155
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-22
Family Pleckstrin-homology domain (PH domain) 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000014   Gene: ENSMPUG00000000014   Transcript: ENSMPUT00000000014
Sequence length 995
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897131.1:507134:634387:1 gene:ENSMPUG00000000014 transcript:ENSMPUT00000000014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIGEAGRTPVMMELMQAKPIYGGWLLLAPDGTDFDNPVHRSRKWQRRFFILYEHGLLRYA
LDEMPTTLPQGTINMNQCTDVVDGEGRTGQKFSLCILTPEKEHFIRAETKEIISGWLEML
MVYPRTNKQNQKKKRKVEPPTPQEPGPAKVAVTSSSSSSSIPSAEKVPTTKSTLWQEEMR
AKDQPDGSSLSPAQSPSPSQPPAASTLREPGLESKDEESAMSSDRMDCGRKVRVESGYFS
LEKTKQDLKAEEQQLPPPLSPPSPSTPNNRRSQVIEKFEALDIEKAEHMETNSSAGPSPS
SDTRQGRSEKRAFPRKRDLPSEAPTAPLPDTSASPLSPHRRAKSLDRRSTESSLTPDLLN
FKKGWLTKQYEDGQWKKHWFVLADQSLRYYRDSAAEEAADLDGEIDLSTCYDVTEYPVQR
NYGFQIHTKEGEFTLSAMTSGIRRNWIQTIMKHVHPTSAPDVTSSLPEEKNRSSSSFETC
LRPSEKPEGERGEPDPEQKRSRARERRREGRSKTFDWAEFRPIQQALAQERASATGASDA
HPEAEAGELERERARRREERRKRFGMLDATDGPAADDMALRMEVDRSPGLPVTADLKTQN
VHVEIEQRWHQVETTPLREEKQVPIAPLHLSSSEDGSDRLSTHELTSLLEKELEQSQKEA
SDLLEQNRLLQDQLRVALGREQSAREGYVLQATCERGFAAMEETHQKKIEDLQRQHQREL
EKLREEKDRLLAEETAATISAIEAMKNAHREEMERELEKSQRSQISSINSDIEALRRQYL
EELQSVQRELEVLSEQYSQKCLENAHLAQALEAERQALRQCQRENQELNAHNQELNNRLA
AEIARLRTLLTGDAGGEAAGSPLTQGKDAYELEVLLRVKESEIQYLKQEISSLKDELQTA
LRDKKYASDKYKDIYTELSIVRAKADCDISRLKEQLKAATEALGEKSPENTPVSGYDIMK
SKSNPDFLKKDRSCVSRQLRNIRSKSVIEQVSWDN
Download sequence
Identical sequences M3XLR4
ENSMPUP00000000014 ENSMPUP00000000014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]