SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000025 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000025
Domain Number 1 Region: 17-153
Classification Level Classification E-value
Superfamily ENTH/VHS domain 1.05e-49
Family VHS domain 0.000000918
Further Details:      
 
Domain Number 2 Region: 149-168,200-306
Classification Level Classification E-value
Superfamily GAT-like domain 1.88e-35
Family GAT domain 0.0000221
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000025   Gene: ENSMPUG00000000025   Transcript: ENSMPUT00000000025
Sequence length 506
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897131.1:1193700:1249992:-1 gene:ENSMPUG00000000025 transcript:ENSMPUT00000000025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLPGPPYSGRNVNPYFTEKATDGSLQSEDWTLNMEICDIINETEEGPKDAIRALKKRLNG
NRNYREVMLALTVLETCVKNCGHRFHILVANRDFIDSVLVKIISPKNNPPTIVQDKVLAL
IQAWADAFRSSPDLTGVVHIYEELKRKGVEFPMADLDALSPIHTPQRSVPEVDPAATMPR
SQSQQRTSSSSYSSPPAPYSAPQAPALSVTGPITANSEQIARLRSELDVVRGNTKVMSEM
LTEMVPGQEDSSDLELLQELNRTCRAMQQRIVELISRVSNEEVTEELLHVNDDLNNVFLR
YERFERYRSGRSVQNASNGVLNEVTEDNLIDLGPGSPAVVSPMVGNTAPPSSLSSQLAGL
DLGTESVSGTLSSLQQCNPRDGFDMFAQTRGNSLAEQRKTVTYEDPQAVGGLASALDSRK
QSSEVIPVAQPSVMDDIEVWLRTDLKGDDLEEGVTSEEFDKFLEERAKAAEMVPSLPSPP
GEAPAPASNPSGRKKAERSEDALFAL
Download sequence
Identical sequences M3XLS5
ENSMPUP00000000025 ENSMPUP00000000025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]