SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000030 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000030
Domain Number 1 Region: 1115-1861
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.11e-263
Family Motor proteins 0.000000000182
Further Details:      
 
Domain Number 2 Region: 2777-2861
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000858
Family SH3-domain 0.0026
Further Details:      
 
Domain Number 3 Region: 3206-3322
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000811
Family Second domain of FERM 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000000030
Domain Number - Region: 3323-3374
Classification Level Classification E-value
Superfamily PH domain-like 0.00246
Family Third domain of FERM 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000030   Gene: ENSMPUG00000000030   Transcript: ENSMPUT00000000030
Sequence length 3438
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897131.1:1425132:1473434:1 gene:ENSMPUG00000000030 transcript:ENSMPUT00000000030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKEEEDEKKAKKGKKGKKAPEPEKPKRSLKGTSRLFMGFRDRTPKISKKGQFRSASAFF
WGLHTGPQKTKRKKKARTVLKSTSKLMTQMRMGKKKRAMKGKKPSFMVIRFPGRRGYGRL
RPRARSLSKASTAINWLTKKFLIKKAEESGSEQATLDAWLNRSDSRVGSRKLPFPSGAEI
LRHGGRLRRFPRSRSIYASGEPVGFLPFEDEAPFRPSGSRRSLYGLEGFQDLGEYYDYHR
EGDDYYDRQSLYQYEEEEPYLGYGGYGGYGPYNPAWPPYGDHPHGYPPEDPYDYYHPDYY
GGPYYPTYPYGYGYEDYEPPYAPPGGYASPYSYYDGYQGEPYPHGYYLDPYAPYEAPYLP
YNLPYDLPYDVPYFDPYGGPYGAPYAEGIYGGADQALYPPEAPYLYPEEPAFAYPWAPPP
ILSPHNPYAHPMDDIAELEEPEEAGGERQSTSFRLPSAAFFEQQGMDKPARSKLSLIRRF
RLFPRPQVKLFGKEKLDVSLPPSLDIPLPLGDEDEDEEEEEMPPVSRVPYAHPFWGFLTP
RQRNLQRALSAFGAHRGLGFGPEFGRPPPRPATSLARFLKKTLSEKKPIPRLRSSQKARP
GGPAVREAAYKRFGYKLAGMDAERPWAAPAHVPLMPPAGWWAFMEPPPASPEVAPDPLAY
PRPRPSFRGSRRLPAAFGLPWTPLPSPQASLRSLPGVGYRSPVGGLSPQPSLRARPFQPP
FSPPPRRPRSLRDPLSPRRGSGRLGPPRSPVLGSPRPPSPPPLLGHSSRCRSLNLTSRLP
HTWRRLSEPPTRAVKPRVRQPFPGPPSAGPWPVAAAAPERRESQRESEDSETPWTVPQLA
PSWDVDMPPAQRPPSPWPGGTGSPRGFSRPPPVPENPFLQHVGPVRPPASQPEDPASDMT
NVFLCRHHDPGPGQLLKSASPIPEKPEEEAALAEPRPPAEPEPSSLTPPKDSLPERKALR
LSLSHPLATCDKMRATGPPWRRWGTLPSAPAPLAPSGAPAPLPKAGERRQAGPGRFAVVM
PQVQKLSAFQRVRPAALQPPVQVTQDPESRPKPIAWSLLLSCFSLPEEAHRPWPQVLTSP
QSCRLGPGANCLRHGGPWEEVGPKSWWNKMHSIRSLPPTRFREQCRDDGVEDMTQLEDLQ
ETTVLSNLKTRFERNLIYTYIGSILVSVNPYRMFGIYGPEHVQQYSGRGLGENPPHLFAI
ANLAFAKMLDAKQNQCIIISGESGSGKTESTKLILRYLAAVNQKRGITQQVQILEATPLL
ESFGNAKTVRNDNSSRFGKFVEVFLEGGMISGAITSQYLLEKSRIVFQAKNERNYHIFYE
LLAGLPAQLRQAFSLQEAETYYYLNQGGNCEISGKSDSDDFRRLLAAMEVLGFSGEDQDS
IFRILASILHLGNVYFEKYETDAQETASVVSAREIQAVAELLQISPEGLQKAITFKVTET
MREKIFTPLTVESAVDARDAIAKVLYALLFGWLIARVNALVSPQQDTLSVAILDIYGFED
LSFNSFEQLCINYANENLQYLFNKIVFQEEQEEYIREQIDWREITFADNQPCINLISLKP
YGILRILDDQCCFPQATDHTFLQKCHYHHGANPLYSKPKMPLPEFTIKHYAGKVTYQVHK
FLDKNHDQVRQDVLDLFVRSRTRVVAHLFSSHAPQAAPQRLGQSSSVTRLHKAHTVAAKF
QQSLLDLVEKMERCNPLFVRCLKPNHKKEPGLFEPDVVMAQLRYSGVLETVRIRKEGFPV
RLPFQVFIDRNLRYRCLVALKHNLPASGDMCVSVLSRLCTVLPSMYRVGVSKLFLKEHLH
QLLESMRERVLHLAALTLQRCLRGFLIRRRFRSLRRKIVLLQSRARGYLARQRYQQMRRN
LVKFRSLVHTYMNHRHYLKLRAERRLRAEEARLRELEELSKREVIAVGHLEVPAELAGLL
QAVAGLRAAQVPRVAPVRTPRLQAEPRVTLPLDINNYPMAKFVRCHFKEPAFGMLTVPLR
TPLTRLPAECHAEAVSVFKLILRFMGDPHLYGAQENVFGNYIVHKGLAIPELRDEILAQL
ANQVWRNPSAHNAERGWFLLATCLSGFAPSSHLNKYLLKFVSDHGQNGFQAVCQHRLMQA
MGQGQQQGSGVARTFPPTQLEWRATQEKASMALDVGCFNGDQFSCPVHSWSTGEEVAGDI
LRHRGLADGWRGWTVAMRHGVQWAELAGHDYVLDLVSNLELLRDFPRQKSYFIVGAEGPV
AGRGGPRALFGNSWDSDEDTPTRPQAQGHVPRVADSDGYCSHNEDGTNGTQRGTANYQDS
DTPGEPSVPHKGLDGYLDSLFDPVLSYGDADLEKPTAIAYRMKGGGQPGGSGSSSTEDPP
RRPPEPKPKPIPGLDASTLALQQAFIHKQAVLLAREMTLQAMALQQQPLGPTPRPLPPEK
PLPPEARPQFVGTGPPAKPVLLRSSPKPLAPAPLAKAPRPPTKPVAVPVLAQHRVCLETT
APCPDLVRYSTLNSEHFPQPTQQIKNIVRQYQQPPRGGRPEALRKDGGKMFAKRPDPHEE
ALMILKGQMGDPAAAGGSQEQVPREAVALVKPVTSTPRPSVGPTPVPPSRSLEPPEEPRQ
TRLHRLVNPNFYGYQDAPWRIFLRKEVFYPKDSYSHPVQLDLLFRQILHDTLSEACLRIS
EDERLKMKALFAQNQLDTQRPLATESVKRAVVSTARDSWEVYFSRLFPATGSVGTGVQIL
AVSHTGIKLLRMVKGSREAGGQLQVLRTYSFADILFVTIPSQNMLEFNLASEKVILFSAR
AHQVKTLVDDFILELKKGSDYVVAVRNFLPEDPALLAFHKGDIIHLQPLEPPRTGYSAGC
VVRKKVVYLEELRRRGPDFGWRFGTIHGRVGRFPSELVQPAAAPDFLQLPAEPGRGRAAA
VAAAVASTAAAWEVGRRREGPPVRAGCPDGAEDGPTLPPYSMLEFAQKYFRDPQRKPQDG
LRLKSKEGRESRTLEDMLCFTPLQESLIELSDSSLNKMATDMFLAVMRFMGDAPLKGQSE
LDVLYTLLKLCGDHEVMRDECYCQVVKQITDNTSTKPDSCQRGWRLLYIVAAYHSCSTVL
QPHLVRFLQDVSRTPGLPFQGIAKACEQNLQKTLRSGGRVELPSSMELRAMLAGRSSKRQ
LFLLPGGLERHLKIKTCTVALDVVEEICAEMALTRPEAFSEYVIFVVTNRGQHVCPLSRS
AYILDVASEMEPVDGGYMLWFRRVLWDQPLKFENELFVTMHYNQVLPDYQKGLFSSVPAS
QPSEQQLQQVSKLALLQHRAKGHSHLPSVREIQDYIPAQLYRSLAGSAWLGLLGQHRQQT
QALSPHQARAQFLGLISALPMFGSSFFFVQSCSNATVPAPCILAVNQNGLNFLSTETHEL
MVKFPLKEIQSTRTQRPTASSSYPYVEIALGDVATQRTMQLQLEQGLELCRVVAVHVENL
LSAREKRLTLPPSEITLL
Download sequence
Identical sequences M3XLT0
ENSMPUP00000000030 ENSMPUP00000000030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]