SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000044 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000044
Domain Number 1 Region: 3-144
Classification Level Classification E-value
Superfamily ENTH/VHS domain 1.25e-57
Family ENTH domain 0.000000416
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000044   Gene: ENSMPUG00000000044   Transcript: ENSMPUT00000000044
Sequence length 583
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897131.1:1893345:1938247:1 gene:ENSMPUG00000000044 transcript:ENSMPUT00000000044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSSIRRQMKNIVNNYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVAFSEIMSMV
WKRLNDHGKNWRHVYKALTLLDYLIKTGSERVAQQCRENIFAIQTLKDFQYIDRDGKDQG
INVREKSKQLVGLLKDEERLKAERAQALKTKERMAQVATGMGSNQITFGRGSSQPNLSTS
YSEQEYGKAGGSPASYHGSPEASLCPQHRAGAPLGQSEELQPLSQRHPFLPHLGLAARPN
GDWSQPCLTCDRAARATSPRVSSELEQARPQTSGEEELQLQLALAMSREVAEQEERLRRG
DDLRLQMALEESRRDTVKVPKKKEHGSHPQQTTLLDLMDALPTSGPAAQKAEPWGRSASA
NQTNPWGGPAAPASTSDPWPPFGAKPAASVDPWGVPTGASTHSGPKGSDPWAAPQQPAPR
AGKTADAWAAASATKPISSSGAFDLFSNLNGTIKDDFSEFDNLRTSKKTAEAVASPPSQN
NGTTSPDPFECQPPTSTSSKPSSARKTPESFLGPNAALVNLDSLVTRPAPPAQSLNPFLA
PGAATASAPVNPFQVNQPQPLTLNQLRGSPVLGTSTSFGPSPD
Download sequence
Identical sequences M3XLU4
ENSMPUP00000000044 ENSMPUP00000000044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]