SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000115 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000115
Domain Number 1 Region: 163-456
Classification Level Classification E-value
Superfamily PP2C-like 6.15e-73
Family PP2C-like 0.0000223
Further Details:      
 
Domain Number 2 Region: 17-75
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000247
Family HLH, helix-loop-helix DNA-binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000115   Gene: ENSMPUG00000000119   Transcript: ENSMPUT00000000119
Sequence length 458
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896909.1:1165172:1214240:-1 gene:ENSMPUG00000000119 transcript:ENSMPUT00000000119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKALATGRDRPSRENEDGWETRGDRKARKPLVEKKRRARINESLQELRLLLAGAEVQAK
LENAEVLELTVRRVQGTLRGRARGKEAQRGPLLFDDLPPASSTDSGSGGPLLFDDLPPAS
SGDSGPLDTAMSQMVKSEEKGAKRKASEGERNGSEELVEKKVCKASSVIFGLKGYVAERK
GEREEMQDAHVILNDITEECRPPSSLITRVSYFAVFDGHGGIRASKFAAQNLHQNLIRKF
PKGDVISVEKTVKRCLLDTFKHTDEEFLKQASSQKPAWKDGSTATCVLAVDNILYIANLG
DSRAILCRFNEESQKHAALSLSKEHNPTQYEERMRIQKAGGNVRDGRVLGVLEVSRSIGD
GQYKRCGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNFILSCLEDEKIQSREG
KPTMDARYEAACNRLASKAVQRGSADNVTVMVVRIGSP
Download sequence
Identical sequences M3XM15
ENSMPUP00000000115 ENSMPUP00000000115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]