SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000129 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000129
Domain Number 1 Region: 323-368
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000453
Family HtrA-like serine proteases 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000129   Gene: ENSMPUG00000000133   Transcript: ENSMPUT00000000133
Sequence length 604
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897042.1:4740355:4794807:-1 gene:ENSMPUG00000000133 transcript:ENSMPUT00000000133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGCVLSGRVRGGKVATGRKEPVTAWFLRGCWGCRRRAFGSLRLTGRRTPGLAYPSAASA
TAMIPVSLVVVVVGGWTAVYLTDLVLKSSVYFKHSYEDWLENNGLSISPFHIRWQTAVFN
RAFYSWGRRKARMLYQWFNFGMVFGVIAMFSSFFLLGKTLMQTLAQMMADSPSSSASSSS
SSSSSSSSASSSSSSSSSSSSSSSSLHNEQVLQVVVPGINLPVNQLTYFFAAVLISGVVH
EIGHGIAAIREQVRFNGFGIFLFVIYPGAFVDLFTTHLQLISPVQQLRIFCAGIWHNFVL
ALLGILALVLLPVILLPFYYTGVGVLITEVAEDSPAVGPRGLFVGDLVTHLQDCPVTNVQ
DWNECLDTIAYEPQIGYCISASTLQQLSFPVRAYKRLDGSTECCNNHSLTDVCFSYRNNF
NKRLHTCLPARKAVEATQVCRTNKDCKKSSSSSFCIIPSLETHTRLIKVKHPPQIDMLYV
GHPLHLHYTVSITSFIPRFNFLSIDLPVVVETFVKYLISLSGALAIVNAVPCFALDGQWI
LNSFLDATLTSVIGDNDIKDLIGFFILLGGSVLLAANVTLGLWMVTARFSSFNSSLCGLF
NISL
Download sequence
Identical sequences M3XM29
ENSMPUP00000000129 ENSMPUP00000000129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]