SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000137 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000137
Domain Number 1 Region: 540-670
Classification Level Classification E-value
Superfamily PH domain-like 1.01e-29
Family Pleckstrin-homology domain (PH domain) 0.008
Further Details:      
 
Domain Number 2 Region: 216-303
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000684
Family PDZ domain 0.015
Further Details:      
 
Domain Number 3 Region: 10-80
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000175
Family SAM (sterile alpha motif) domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000137   Gene: ENSMPUG00000000140   Transcript: ENSMPUT00000000141
Sequence length 900
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897042.1:4991720:5210639:-1 gene:ENSMPUG00000000140 transcript:ENSMPUT00000000141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAIHIWVEKKWMIELVQSWNRRLDDCLQQYIKNFEREKISGDQLLRITHQELEDLGVSRI
GHQELILEAVDLLCALNYGLETENLKTLSHKLNASAKNLQNFITGRRRSGHYDGRTSRKL
PNDFLTSVVDLIGAAKSLLAWLDRSPFAAVTDYSVTRNNVIQLCLELTTIVQQDCTVYET
ENKILHVIFCRTVLGILSKMLRLSIFPLLSLSSSLIIIKLASILSYKGEGMYIKSTYDGL
HVITGTTENSPADRCKKIHAGDEVIQVNHQTVVGWQLKNLVNALREDPSGVILTLKKRPQ
SMLTSAPALLKNMRWKPLALQPLIPRSPTSSVATPSSTISTPTKRDSSALQDLYIPPPPA
EPYIPRDEKGNLPCEDLRGHMVGKPVHKGSESPNSFLDQEYRKRFNIVEEDTVLYCYEYE
KGRSSSQGRRESTPTYGKLRPISMPVEYNWVGDYEDPNKMKRDSRRENSLLRYMSNEKIA
QEEYMFQRNSKKDTGKKSKKKSDKSNSPTHYSLLPSLQMDALRQDIMGTPVPETTLYHTF
QQSSLQHKSKKKNKGPIAGKSKRRISCKDLGRGDCEGWLWKKKDAKSYFSQKWKKYWFVL
KDASLYWYINEEDEKAEGFISLPEFKIDRASECRKKYMAKALYKKKKRFFFSKVHFKDMN
RWLNRINMLTAGYAERERIKQEQDYWSESDKEEADTPSTPKQDSPPPPYDTYPRPPSMSC
ASPYVEAKHSRLSSTETSQSQSSHEEFRQEVTGSSAVSPIRKTASQRRSWQDLIETPLTS
SGLHYLQTLPLEDSVFSDSAAISPEHRRQSTLPTQKCHLQDHYGPYPLAESERMQVLNGN
GGKPRSFTLPRDSGFNHCCLNAPVSACDPQDDVQPTEVEEEEEEEEEEGEAAGENIGDKS
Download sequence
Identical sequences M3XM37
ENSMPUP00000000137 ENSMPUP00000000137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]