SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000139 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000139
Domain Number 1 Region: 5-364
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.02e-134
Family Motor proteins 0.0000000000035
Further Details:      
 
Domain Number 2 Region: 500-605
Classification Level Classification E-value
Superfamily SMAD/FHA domain 4.26e-28
Family FHA domain 0.00000739
Further Details:      
 
Domain Number 3 Region: 1590-1687
Classification Level Classification E-value
Superfamily PH domain-like 1.59e-23
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000139   Gene: ENSMPUG00000000142   Transcript: ENSMPUT00000000143
Sequence length 1708
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896909.1:2950785:3040941:-1 gene:ENSMPUG00000000142 transcript:ENSMPUT00000000143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIINPKQPKETPKSFSFDYSYWSHT
SPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQQGIIP
QLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVED
LSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQKRHDAETDITTEK
VSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMDSGPNKNKKKKK
TDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAVI
NEDPNNKLIRELKDEVTRLRDLLYAQGLGDITDTNTVPGGPKLTNALVGMSPSSSLSALS
SRAASVSSLHECLLFAPGSEEAIERLKETEKIIAELNETWEEKLRRTEAIRMEREALLAE
MGVAMREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGREDAERRQDIVL
SGHFIKEEHCIFRSDSRGGSEAVVTLEPCEGADTYVNGKKVTEPSILRSGNRIIMGKSHV
FRFNHPEQARQERERTPCAETPAEPVDWAFAQRELLEKQGIDMKQEMEQRLQELEDQYRR
EREEATYLLEQQRLDYESKLEALQRQMDSRYYPEVNEEEEEPEDEVQWTERECELALWAF
RKWKWYQFTSLRDLLWGNAIFLKEANAISVELKKKVQFQFVLLTDTLYSPLPPDLLPPEA
AKDRETRPFPRTIVAVEVQDQKNGATHYWTLEKLRQRLDLMREMYDRAAEVPSSVIEDCD
NVVTGGDPFYDRFPWFRLVGRAFVYLSNLLYPVPLVHRVAVVSEKGEVKGFLRVAVQATS
ADEEAPDYGSGVRQSGTARISFDDQHFEKFQSESCPVVGMSRSGTSQEELRIVEGQGQGA
DAGPSADEVNNNTCSAVSPEGLLLDSPEKAPLDGPLDATLDHLRLGNTFTFRVTVLQASS
ISAEYADIFCQFNFIHRHDEAFSTEPLKNTGRGPPLGFYHVQNIAVEVTKSFIEYIKSQP
IVFEVFGHYQQHPFPPLCKDVLSPLRPSRRHFPRVMPLSKPVPATKLSTLARPCPGPCHC
KYDLLVYFEICELEANGDYIPAVVDHRGGMPCMGTFLLHQGIQRRITVTLLHETGSHIRW
KEVRELVVGRIRNTPETDESLIDPNILSLNILSSDYIHPAQDDRQFLDSDMPRTFYQFEA
AWDSSMHNSLLLNRVTPYREKIYMTVSAYIEMENCTQPAVITKDFCMVFYSRDAKLPASR
SIRNLFGSGSLRASESNRVTGVYELSLCHVADAGSPGMQRRRRRVLDTSVAYVRGEENLA
GWRPRSDSLILDHQWELEKLSLLQEVEKTRHYLLLREKLETTQRPGPEAPSPASSEDSGS
HGSSSPSSPLSAEGRPSPVEAPNERQRELAVKCLRLLTHTFNREYTHSHVCVSASESKLS
EMSVTLLRDPSMSPLGAATLTPSSTCPSLVEGRYGAAELRTPQPCSRPASPDAEPVPEAD
SKKLPSPARATEAEKEPQRLLVPDIQEIRVSPIVSKKGYLHFLEPHTAGWAKRFVVVRRP
YAYLYNSDKDSVERFVLNLSTAQVEYSEDQQAMLKTPNTFAVCTEHRGILLQANSDKDMH
DWLYAFNPLLAGTIRSKLSRRRSAQMRV
Download sequence
Identical sequences M3XM39
ENSMPUP00000000139 ENSMPUP00000000139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]