SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000162 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000162
Domain Number 1 Region: 591-729
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.58e-43
Family PLC-like (P variant) 0.0000448
Further Details:      
 
Domain Number 2 Region: 763-899
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.37e-37
Family PLC-like (P variant) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000162   Gene: ENSMPUG00000000165   Transcript: ENSMPUT00000000166
Sequence length 1258
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896964.1:240329:293413:1 gene:ENSMPUG00000000165 transcript:ENSMPUT00000000166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTFSGTLGKNIKAQPPLNRMSREELEDSLFRLREEHLLVKELSWKQQDEIKRMRTALLRL
TSMGRNMRAEVAEAEQPARLRRNAGWRQPPTKHHRPLMHGLQLQFQRVVRPAPQHSQPWV
HVGHRQLRTAGAPALEKPKRGPTDRLSYTAPPTFKNHGTNGKTRGEISSELLKMGNNSVI
SFSKVIITTKLIGLCMPNCAHIMTSNTMLVEEQPKSPEKMWSKDEDFEQRSSLECAQKAT
ELRASIKENIELIRLKKLLHERNTSLVATKAQLTEVQEAYETLLQKNQGILSTAHDALLG
QVNELRAELKEQSKKAVSFKSQLEDVSILQITLKEFQERVEDLEKERNLLNDNYEKLLEN
MLDSSNQPHWSTELAGEQLQQKVCQLQDQLDAELEEKRKVLLQLSREKAQNRDLQLEVTN
LLQKHKQEVEILQNKETISQSPDRQSEPATHPALFQETTSTEPCEPKNQEEEKLSQMLSE
LQVSHAETVLELEKTRDMLILQRKINVCYQEELEAMMTKADNENKDHREKMERLNQLLDL
KNNRINQLEGILRSHGLPLSEQLKDVAYGTRQLSLCLETLPSHGDEEKVDISLLHQSENL
FELHIHQAFLTSAALAQAGDTQPTTFCTYSFYDFETHCTPLAVGPQPLYDFTSQYVVETD
SLFLNYLHGASARLDLYQAIASEHHTLAAAWICFERVLETVEKVHGSTTLTGASGEDFGV
LEYWMRLRFPIGPSLQAGNKRKKAQAYLSASVLGVWEAREDKSRLETWKHQNELRVEIIR
CYGLRSRRLGTQPSPYVMYRFFTFSDHDTAIIPASNNPYFRDQARFPVLVTSDLDKYLRR
EALSVYVFDDEDSEPGSYLGRVQVPLLPLAQNKSIKGDFNLTDPVGNPNGFVEAQLDWKS
FYLPPESFLKPEAQPEEKNTKNSVEISSEEEKPSFSPQDQMAFAEIPIEVGQYQAKRKPP
QVGERKEREHQVASYSRRKHGKRTGVQGKNRMEYLSRNILTGNTLQQVNYTEWKFSGLKS
SRDDGLKNQQKEEEMTSSHSAVLQKEALIPINDKESCEQASEVSEAQTTDSDEIVTPVSL
KCPKAGSEKMCIEIVSLAFYPEAEVMCDENVKQVYVEYKFYGLPLSETETPVSLRKPRAG
EEIHFHFSKVIDLDPLAQKGRRQFLFAMLKKQDPEQGRLKFTVVSDPLDDEKKECQEVGY
AFLELWQIMQSGRDGVEQELEIVSPGDQVTQIGRLKVSLQAAAALQAIYKEMTEDTFS
Download sequence
Identical sequences M3XM62
ENSMPUP00000000162 ENSMPUP00000000162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]