SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000172 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000172
Domain Number 1 Region: 559-772
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.84e-50
Family DBL homology domain (DH-domain) 0.00039
Further Details:      
 
Domain Number 2 Region: 251-395
Classification Level Classification E-value
Superfamily PH domain-like 1.26e-42
Family Third domain of FERM 0.00059
Further Details:      
 
Domain Number 3 Region: 889-1048
Classification Level Classification E-value
Superfamily PH domain-like 5.36e-32
Family Pleckstrin-homology domain (PH domain) 0.0018
Further Details:      
 
Domain Number 4 Region: 150-250
Classification Level Classification E-value
Superfamily Second domain of FERM 1.14e-29
Family Second domain of FERM 0.00011
Further Details:      
 
Domain Number 5 Region: 756-880
Classification Level Classification E-value
Superfamily PH domain-like 2.47e-29
Family Pleckstrin-homology domain (PH domain) 0.0066
Further Details:      
 
Domain Number 6 Region: 69-150
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.69e-20
Family First domain of FERM 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000172   Gene: ENSMPUG00000000175   Transcript: ENSMPUT00000000176
Sequence length 1062
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896909.1:3467282:3565604:1 gene:ENSMPUG00000000175 transcript:ENSMPUT00000000176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLWGFLLCFKGFSWWRMGEIEGTYRVLQTPGTRLGSPTPTGVSTLEPGQTLSVTAARAS
ARMQEKHLHIRVKLLDNTVEIFDIEPKRDGQMLLTQVWRRLNLTECDYFGLEFQHPRSYW
IWLEPMKPIIRQVRRPKNALLRLAVKFFPPDPGQLQEEYTRYLFALQLKRDLLEERLPCT
DTTAALLASHLLQAEIGDYDETLDREHLKANEYLPSQEHSLEKILEFHRKHTGQTPAESD
FQVLEIARKLEMYGIRFHTASDREGARINLAVSHMGVLVFQGTTKINTFNWSRVRKLSFK
RKRFLIKLHPEVRGPYQDTLEFLLGSRDECKNFWKICVEYHTFFRLLDQPKAKAKAVFFS
RGSSFRYSGRTQKQLVDYVRDSGVKRVPYERRHSKTRMSIRALTADLPRQSISFTEGLRT
SASPSSTNVSFYSVPTSPLAPRGPPDFKDSSSSLTEPQAPDAKRPAAERSSGAAADGDTR
WAQSPGPPALQPCQGLSMESPQPSPTTRKSPLSLSPASQVTLGPAGQSLSPLLSPVLSHV
GGARTDNEEQPKHKSMAADEAYFIAKEILATERTYLKDLEVLTVWFRSAVVKEDAMPADL
MTLLFSNIDPIYEFHRGFLREVEQRLALWEGSSDTHVPGGHQRIGDILLRNMHQLKGFTS
CFQRHDEVLTELEKATKRLKKLEAVYREFELQKVCYLPLNAFLLKPIQRLLHYRLLLGRL
CTHYGPAHPDHADCHDALQAITEVTSTLQHSLARLENLQKLTELQRDLVGIENLITPGRE
FIREGCLHKLTKKGLQQRMFFLFSDMLLYTSKGVTGSSHFRIRGRLPLHGMLVEEGEHER
PVPHCFTICAAQKTVVVAASTRLEKEKWICDLNTAIDAAKSRSGQSLVLPGSVVCMPPSR
CMEEVSPEQESEDARSSRGSLEGQGQPRANTTVRVCWYRNTSVSRADHSAAVENQLSGYL
LRKFKNSNGWQKLWVVFTNFCLFFYKTHQDDYPLASLPLLGYSVSVPKEADGVHKEHVFK
LQFKSHVYFFRAESKYTFGRWMEVIERAGSSPGRARRPEEEA
Download sequence
Identical sequences M3XM72
ENSMPUP00000000172 ENSMPUP00000000172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]