SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000216 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000216
Domain Number 1 Region: 367-580
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-60
Family DBL homology domain (DH-domain) 0.00011
Further Details:      
 
Domain Number 2 Region: 563-724
Classification Level Classification E-value
Superfamily PH domain-like 4.03e-34
Family Pleckstrin-homology domain (PH domain) 0.0026
Further Details:      
 
Domain Number 3 Region: 747-908
Classification Level Classification E-value
Superfamily PH domain-like 2.34e-22
Family Pleckstrin-homology domain (PH domain) 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000216   Gene: ENSMPUG00000000219   Transcript: ENSMPUT00000000220
Sequence length 914
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897063.1:1327617:1531810:1 gene:ENSMPUG00000000219 transcript:ENSMPUT00000000220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGEGGYNFRRTAIRRKPGPFCLPLGTPQPWRPSGSHWGRPETDAFRSRAPADRPDTQIE
VHGEVGFPKILQQVAGCSYSSSSSSVPSSSTCPKITVVPPYLKRSRTPQVDQNVSNEEAQ
GINGKTPAKHSAASPKPQVPPKPLHLQNSPSSNIHQTPRHKALSSEKPRMEEVKPASASC
VSKEKPSKVSDLISRFEGGSTLSNYSDLKKDSGVNLNVPRTPGRHGLATTPQQKLLSQHP
PLKLENDTDPTQGVQTGVANGVIAAQNQIEWEEDKAATLSPETPVQALEPLLAVSLVNGE
GEEEATTGPASPTAKDDDGNAADSSCRTPRVSQVLPLEEGRADTEAQVQEREDGESPLES
DQLDPHPEMKETNEQKLHKIANELLLTERAYVNRLDLLDQVFYCKLLEEANRGSFPAEMV
NKIFSNISSINAFHSKFLLPELEKRMQEWETTPRIGDILQKLAPFLKMYGEYVKGFDNAM
ELVKNMTERTPQFKSVVEEIQKQKICGSLTLQHHMLEPVQRIPRYEMLLKDYLRKLPPDS
PDWNDAKKSLEIISTAASHSNSAIRKMENLKKLLEIYEMLGEEEDIVNPSNELIKEGQIL
KLAARNTSAQERYLFLFNNMLLYCVPRFSLVGSKFTVRTRVGIDGMKIVETHNEEYPHTF
QVSGKERTLELQASSEQDKEEWIKALQDTIDAFHQRHETFRNAIAKDNDMQSEVSTAELG
KRAPRWIRDNEVTMCMKCKESFNALTRRRHHCRACGHVVCWKCSDYKAQLEYDGGKLNKV
CKDCYQIISGFTDSEEKKRKGILEIESAEVSGNSVVCSFLQYMEKSKPWQKAWCVIPKQD
PLVLYMYGAPQDVRAQATIPLLGYVVDDLPKSADLPHSFKLTQSKSVHSFAADSEELKQK
WLKIIFLAVTGYGW
Download sequence
Identical sequences M3XMB6
ENSMPUP00000000216 ENSMPUP00000000216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]