SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000222 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000222
Domain Number 1 Region: 364-499
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.41e-40
Family Synaptotagmin-like (S variant) 0.00000698
Further Details:      
 
Domain Number 2 Region: 226-337
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.82e-39
Family Synaptotagmin-like (S variant) 0.0000646
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000222   Gene: ENSMPUG00000000225   Transcript: ENSMPUT00000000226
Sequence length 523
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897063.1:2131416:2194675:-1 gene:ENSMPUG00000000225 transcript:ENSMPUT00000000226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFHKEDGVSSLCQKALHIVTELCFAGQVEWEKCSGIFPRDRGSQGGSSTDISVSLLAVV
VSFCGLALLVVSLFVFWKLCWPCWKSKPVTSNISTLPQSISSAPTEVFETEEKKEVKDNE
KPALKVIEPAIKISHTSPDIPAEVQTALKEHLIKHARVQRQTTEPTSSSRHNSFRRHLPR
QMQVSSVDFSMGTEPVLQRGETTTSIGRIKPELYKQKSVDSEGNRQEDIKTCGKLNFTLQ
YDYENELLVVKIIKALDLPAKDFTGTSDPYVKMYLLPDRKKKFQTRVHRKTLNPLFDETF
QFPVAYDQLSNRKLHFSVYDFDRFSRHDMIGEVILDNLFEVSDLSREATVWKDIHCATTE
SIDLGEIMFSLCYLPTAGRMTLTVIKCRNLKAMDITGSSDPYVKVSLMCEGRRLKKRKTT
TKKNTLNPVYNEAIIFDIPPENVDQVSLSIAVMDYDRVGHNEVIGVCRTGLDAEGLGRDH
WNEMLAYHRKPITHWHPLLELPGRATSFESQGSCPSPKPPSTP
Download sequence
Identical sequences M3XMC2
XP_004771881.1.14098 ENSMPUP00000000222 ENSMPUP00000000222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]