SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000225 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000225
Domain Number 1 Region: 172-289
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.96e-25
Family Synaptotagmin-like (S variant) 0.016
Further Details:      
 
Domain Number 2 Region: 30-161
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.12e-21
Family Synaptotagmin-like (S variant) 0.031
Further Details:      
 
Domain Number 3 Region: 320-501
Classification Level Classification E-value
Superfamily vWA-like 5.28e-17
Family Integrin A (or I) domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000225   Gene: ENSMPUG00000000228   Transcript: ENSMPUT00000000229
Sequence length 577
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897063.1:2973606:3194864:-1 gene:ENSMPUG00000000228 transcript:ENSMPUT00000000229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWAPDKSTAPPPKMDSRYTSTAGIGDLNQLSAAIPATRVEVSVSCRNLLDRDTFSKSDPI
CVLYVQGVGNKEWREFGRTEVIDNTLNPDFVRKFILDYFFEERENLRFDLYDVDSKSPNL
SKHDFLGQVFCTLGEIVGSQGSRLEKPIVGIPGRKCGTIILTAEELNCCRDAVLMQFCAN
KLDKKDFFGKSDPFLVFYRSNEDGSFTICHKTEVVKNTLNPVWQAFKISVRALCNGDYDR
TIKVEVYDWDRDGSHDFIGEFTTSYRELSRGQSQFNVYEVVNPKKKGKKKKYTNSGTVTL
LSFLVETEVSFLDYIKGGTQINFTVAIDFTASNGNPAQPTSLHYMNPYQLNAYGMALKAV
GEIVQDYDSDKMFPALGFGAKLPPDGRISHEFALNGNPQNPYCDGIEGVMEAYYRSLKSV
QLYGPTNFAPVINHVARYASSVKDGSQYFVLLIVTDGVISDMAQTKESIVNASKLPMSII
IVGVGPAEFDAMVELDGDDVRVSSRGKYAERDIVQFVPFRDYIDRSGNHILSMARLAKDV
LAEIPEQFLSYMRARGIKPSPAPPPYTPPTHVLQTQI
Download sequence
Identical sequences M3XMC5
ENSMPUP00000000225 ENSMPUP00000000225 XP_004771885.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]