SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000247 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000000247
Domain Number - Region: 6-145
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000311
Family PLC-like (P variant) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000247   Gene: ENSMPUG00000000250   Transcript: ENSMPUT00000000251
Sequence length 558
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897001.1:699152:795005:-1 gene:ENSMPUG00000000250 transcript:ENSMPUT00000000251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRITLKGSEIKEPEITPEVPTLVPFGDVVGCIAIHIKNCRHFTPKISLQHFKNLFIRIS
INNIVKCTKICSLASPNGEKYTTVNFDDTKYFSVQVPRRQDDERNNIYLELMQYRSTEKY
PLLLGSVKVHLYDVIQKGCFIEEFEMLHKNLPICKVAVEFMFSYGNFGYGFSHQLKPLQK
INKPSMFMNIAPPPGRIDPVTNVITPQPIEYPAFLSPDLNVTVGAPAVVPNQSSVVRLEK
LQQQPRERLEKMKKEYRNLNTWIEKANYLEGILNPKMAHQELKVINIIHSLHITSNTFYF
KKIVIIKITDFPFVMEEAETVPSELLDNDDKKSLTLPTLNQSNQDNSRAVASESDESTKT
PWPVIPILTITDQNQTSPLEEYQSKAAPEGGKNMFLTPDVKWKDRYPKLLKTDSSSSEVI
FSPKENIIPYFRPEYIESKPNYQDCSDRFEDIPVTSFKNVEQSKSRARLLGKSPDDNHNH
LKHFARPNTAPEVHKRRESYHGKLTSPRMISAGLVHINDAIPDYEIQKMRQKKKLKENIE
KCSLICDIIQMLKVQNNM
Download sequence
Identical sequences M3XME7
ENSMPUP00000000247 ENSMPUP00000000247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]