SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000260 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000260
Domain Number 1 Region: 86-192
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000299
Family PARP-type zinc finger 0.0000373
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000260   Gene: ENSMPUG00000000262   Transcript: ENSMPUT00000000264
Sequence length 289
Comment pep:novel scaffold:MusPutFur1.0:GL896978.1:1016098:1017496:-1 gene:ENSMPUG00000000262 transcript:ENSMPUT00000000264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITLAFKSPFPPNIYTLSSKELCPFQEQHHWPDIKQFSHWSETDLLHGNYILQKKKACSLL
QESNLRPCFTCLVFLPGQVEFCSGSFEIAKRGMASCKKKKKKKKTGNEKIVQSSAHPFSG
SRGDMREWYHIKCTFEKLKWAQATTKDIEDHIELESWEELEDNEKAQIIQHIADLSSKAI
GTLKKKAIVQAKLIATGQVTSPVKDVSFVTNTNPQKFSGFSVKPKNFGEACSSQTLKAIF
SSKCVPKHKYCPLCELSKLCAMVAENPGYNTKTQIIQDFLWKSKSGGRA
Download sequence
Identical sequences M3XMG0
ENSMPUP00000000260 ENSMPUP00000000260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]