SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000295 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000295
Domain Number 1 Region: 206-268
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.8e-20
Family LIM domain 0.0069
Further Details:      
 
Domain Number 2 Region: 265-327
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.34e-19
Family LIM domain 0.00077
Further Details:      
 
Domain Number 3 Region: 324-386
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.91e-18
Family LIM domain 0.0016
Further Details:      
 
Domain Number 4 Region: 179-210
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000114
Family LIM domain 0.01
Further Details:      
 
Domain Number 5 Region: 383-412
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000286
Family LIM domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000295   Gene: ENSMPUG00000000297   Transcript: ENSMPUT00000000299
Sequence length 414
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897149.1:1625273:1660570:-1 gene:ENSMPUG00000000297 transcript:ENSMPUT00000000299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLQSIQESSTCHSSSSQPVGPEHLGCVTMEELDALLEELEHSTLQDSDEPSSPAPLPLD
QRSRKDSDLAETSETIVQNDTSSLPVQLVYTTHIQEPNIYSKVQEPEEASHPPKTSAAAQ
LDELMAHLCEMQTQVAVKADASKKHPANKQDPKASLDSMLGDLEQDLQDLGVATVSKGHC
ASCRKPIAGKVIHALGQVWHPEHFVCTHCKEEIGPQPFFERSGLAYCPKDYHDLFSPRCA
YCAAPILDKVLTAMNQTWHPEHFFCFHCGEVFGAEGFHEKDKKPYCKKDFLAMFSPKCGG
CNRPVLENYLSAMDTVWHPECFVCGDCFSSFSSGSFFELDGRPYCELHYHQRRGTLCHGC
GQPITGRCISAMGHKFHPEHFVCAFCLTQLSKGIFREQDDKTYCQPCFTKLFPL
Download sequence
Identical sequences M3XMJ5
ENSMPUP00000000295 ENSMPUP00000000295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]