SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000312 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000312
Domain Number 1 Region: 1378-1429,1475-1655
Classification Level Classification E-value
Superfamily VPS9 domain 2.48e-41
Family VPS9 domain 0.0021
Further Details:      
 
Domain Number 2 Region: 13-218
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 6.28e-38
Family Regulator of chromosome condensation RCC1 0.0057
Further Details:      
 
Domain Number 3 Region: 522-687
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.31e-26
Family beta-lactamase inhibitor protein-II, BLIP-II 0.066
Further Details:      
 
Domain Number 4 Region: 1047-1136
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 1.16e-23
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0099
Further Details:      
 
Domain Number 5 Region: 1141-1249
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 2.22e-18
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.024
Further Details:      
 
Domain Number 6 Region: 692-891
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00000000000707
Family DBL homology domain (DH-domain) 0.006
Further Details:      
 
Domain Number 7 Region: 927-1013
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000011
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000312   Gene: ENSMPUG00000000314   Transcript: ENSMPUT00000000316
Sequence length 1657
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897001.1:893542:968185:-1 gene:ENSMPUG00000000314 transcript:ENSMPUT00000000316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSKKRSSTEAEGSKERGLVHVWQAGSNSVAPERLPGWGGKAVLQAALGVKHGVLLTEDG
EVYSFGTLPWRSEPAEICPNSPILENALVGQYVVTVASGSFHSGAVTESGVVYMWGENSA
GQCAVANQQYVPEPNPVSISDSETSSLVAVRILQLACGEEHTLALSISREIWAWGTGCQL
GLITTAFPVTKPQKVEHLAGRVVLQVACGAFHSLALVQCLPSQELKPVPERCNQCSQLLI
TMTDKEDHVIISDSHCCPLGVTLSESQAENQVSTAISPCTETLDSQGEVFENTLGGKEPP
VATDTNVGNVQTTGGDAISSQQDVVETTEISSARNVPSYPDTQAVNEYMAKLSDRSVREN
SENGEKPVPSQPLVEEAVPNLHSPPTTSTSALNSLVVSCASAVGVRVAATYEAGALSLKK
VMNFYSMAPCEPGTQAGSSSIGPEGLKDSREEQVKQESMQGKKSSSLVDIREEESEGGSR
RLSLPGLLSQVSPRLLRKAARVKTRTVVLTPTYSGEADALLPSLRTEVWTWGKGKEGQLG
HGDVLPRLQPLCVKCLDGKEVIYLEAGGYHSLALTAKSQVYSWGSNTFGQLGHYDFPTTV
PRLAKVNSENGVWSVAAGQDYSLFLVDTEDFQPGLYYSGRQDPAEGDNLPENHSGTKTPV
LLSCSKLGYISRVTAGKDRYLALVDKNVMGYIASLHELATTERRFYSKLSDIKSQILRPL
LSLENLGTASTVQLLQEVASRFSKLCYLIGQHGASLSNFLHGIKEARSLVILKHASLFLD
SYTEYCTSITNFLVMGGFQLLAKPAIDFLNKNQELLQDLSEVNDENTQLMEILNTLFFLP
IRRLHNYAKVLLKLATCFEVTSPDYQKLQDSSSCYESLALHLGRRRKEAEYTLGFWKTFP
GKMTDSLRKPERRLLCESSNRALSLQHAGRFSVNWFILFNDALVHAQFSTHHVFPLATLW
AEPLSEEAGGVNGLKITTPEEQFTLVSSTPQEKTKWLRAISQAVDQALRGTSDLPPYGSG
SGIQRQEPPISRSAKYTFYKDPRLKDATYDGRWLSGKPHGRGVLKWPDGKMYSGMFRNGL
EDGYGEYRIPNKALNKEDHYVGHWKEGKMCGQGVYSYASGEVFEGCFQDNMRHGHGLLRS
GKLTSSSPSMFIGQWVMDKKAGYGVFDDITRGEKYMGMWQDDVCQGNGVVVTQFGLYYEG
NFHLNKMMGNGVLLSEDDTIYEGEFSDDWTLSGKGTLTMPNGDYIEGYFSGEWGSGIKIT
GTYFKPSLYESDKDRPKVFRKLGNLAVSADEKWKAVFDECWHQLGCENPGQGEVWKAWDN
IAVALTTSRRQHRDSPETLSRSQTQTLESLEFIPQHVGAFSVEKYDDIKKYLIKACDTPL
HPLGRLVETLVAVYRMTYVGVGANRRLLQEAVKEIKSYLKRIFQLVKFLFPELPEEGSTI
PLSAPLPTERKSFCTGKSDSRSESPEPGYVVTSSGLLLPVLLPRLYPPLFMLYALDNDRE
EDIYWECVLRLNKQPDIALLGFLGVQRKFWPATLSILGESKKVLPTTKDACFASAVECLQ
QISTTFTPSDKLKVIQQTFEEISQSVLASLQEDFLWSMDDLFPVFLYVVLRARIRNLGSE
VHLIEDLMDPYLQHGEQGIMFTTLKACYYQIQREKLN
Download sequence
Identical sequences M3XML2
ENSMPUP00000000312 ENSMPUP00000000312 XP_004764228.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]