SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000358 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000358
Domain Number 1 Region: 157-454
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.15e-75
Family Protein kinases, catalytic subunit 0.000055
Further Details:      
 
Domain Number 2 Region: 1-115
Classification Level Classification E-value
Superfamily DEATH domain 6.59e-39
Family DEATH domain, DD 0.00000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000358   Gene: ENSMPUG00000000361   Transcript: ENSMPUT00000000365
Sequence length 460
Comment pep:known scaffold:MusPutFur1.0:GL897011.1:2894072:2913822:1 gene:ENSMPUG00000000361 transcript:ENSMPUT00000000365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKPITSSTYVRCLNLGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALL
QTGKSPTCELLFDWGTTNCTVGDLVDLLIQNEFFAAASLLLPDAVPKTVNILPSNEAVTV
QQKQLPLCGKDRTFVVPVQNLEQNFMPPDSSSPENPSLEGSDTRFHNFSFYELKNVTNNF
DERPISLGGNKMGEGGFGVVYKGFMNNKTVAVKKLAAMVDISTEELRQQFDQEIKVMAKC
QHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDDTPPLPWHMRCKIAQDAANGIS
FLHENHHIHRDIKSANILLDKDFTAKISDFGLARASEKFSQTVMTSRIVGTTAYMAPEAL
RGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYVDTKMND
TDPASIEAMYCIASQCLHEKKNKRPDIKKVQQLLQDMTAS
Download sequence
Identical sequences G9K636
ENSMPUP00000000358 ENSMPUP00000000358 XP_004765620.1.14098 XP_012918479.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]