SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000383 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000383
Domain Number 1 Region: 2012-2312
Classification Level Classification E-value
Superfamily BEACH domain 6.02e-126
Family BEACH domain 0.00000000844
Further Details:      
 
Domain Number 2 Region: 2432-2685
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.11e-28
Family WD40-repeat 0.0035
Further Details:      
 
Domain Number 3 Region: 1915-2011
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-26
Family PreBEACH PH-like domain 0.004
Further Details:      
 
Domain Number 4 Region: 11-367,403-566,890-913,954-1148,1177-1195
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000000643
Family Mo25 protein 0.085
Further Details:      
 
Domain Number 5 Region: 598-748
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000132
Family Laminin G-like module 0.053
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000000383
Domain Number - Region: 983-1067,1131-1145,1176-1283,1615-1715
Classification Level Classification E-value
Superfamily ARM repeat 0.0518
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000383   Gene: ENSMPUG00000000385   Transcript: ENSMPUT00000000390
Sequence length 2722
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897001.1:1999691:2196229:1 gene:ENSMPUG00000000385 transcript:ENSMPUT00000000390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRERLFELWMLYCTKKDPDYLKLWLDNFVSSYEQFLDVDFEKLPTRVDDVPPGISLLP
DNILQVLRIQLLQCVQKMADGLEEQQQALSVLLVKFFIILCRNLSNVEEIGTCSYINHVI
TMTTLYIQQLKSKKKEKELADQTSIEEFVIHALAFCESLYDPYRNWRHRISGRILSTVEK
SRQKYKPASLTVEFVPFFYQCFQESEHLKESLKCCLLHLFGAIVAGGQRNALQAISPATM
EVLMRVLADCDSWEDGNPEEVGRKIELTLKCLTEVVHILLTSSSDQRQVETSTILENYFK
LLNSDHSALPNQRRSRQWESRFIALQIKMLNTITAMLDCTDRPVLQAIFLNSNCFEHLIR
LLQNCKLFLNANNKVADKNEKDLANKLLTEINEDQVFQGQLDCLAISAIQALTAVMNKSP
AAKEVFKERIGYTHMFEVLKSLGQPPLELLKELMNMAVEGDHTSVGILGISNVHPLLLLI
QWLPELESHDLQIFISDWLKRICCINRQSRTICVNANMGIHIIETLDSHSSLHRTCAENL
IALHGSLGSQSVSSEEIRRLLRLLRVDEPEYIHPYTTPVTRAILTMARKQSLESALQYFN
LSHSMAGISVPSIQKWPGSAFSFNAWFCLDQDQLTLGNANKGGKRKQLYSFFTGSGMGFE
AFITHSGMLVVAVCTKREYATVMLPDHSFCDSLWHNITIVHMPGKRPFGQSLVFIYDNGQ
QKVSAPLRFPAMNEPFISCCIGSAGQRTTTPPPSQIPDPPFSSPITPHRTSFGGILSSAS
WGGTLEKSKLITKLISAGTQDSEWGCPTSLEGQLGSVIIFFEALQPPQVKALYLAGPNCL
SPWKFQESDMGDLPANILLHYTAKACKNSICLDLSTNCLHGRLTGNKVVNWDIKDIINCI
GGLNVLFPLLEQISHLGEGQISEGMNESTVSELITPVEGDWVVLTSTKASESRLERNLIA
TFILIVKHFIQRHPINQDNLTHSHGVATLGALLQKVPSSLMDVNVLMAVQLLIEQVSLEK
NMQLLQQMYQYLLFDFRIWNRGDFPFRIGHIQYLSTIIKDSRRVFRKKYGVQFLLDTLRI
YYGSDCKYSELSLDDIRTIRTSLYGLIKYFLCKGGTHEEIQSIMGYIAAINEEEQLFGIL
DMLFSLLRTSPTRGQLFLLLFEPGNADILYALLLNQKYSDRLREIVFKVMEQMLKCTNVY
ERSKQRIRLREVGYSGLGLLLNEAPINTSLIKSLTNQIINTDPAINFKDLLSVVYISHRT
HINVRVVICRKILQILLSQPDAAHQISQQVGWQDTLVRLFLKTNFENGNTLHKHSRAVSV
KDSDKNLSAEDTKKNFDEKIDEEKINSFASANVSSDQWSLEDGHSLDSSTPLFQEDSSVG
ELSFRSENQEEFWNNNPSHLSLDLSGIDSCELSDSGSHMPDSLPSTPSPIESTKSFSVQS
DKESGVINDPGFGDDFSLLESQERCEEELLQLLTNILNYVMCRGLEKSDDSTWIERGQVF
SALSKPGISSELLRPSDEIKLILLQNMLEWTVTENRESKMNPVTAENAFRLILIIQDFLQ
SEGLVNSNMWTEKLLDDLMLLFDGLSVWYSESQVWAKLSRIQIQLLLGFIGRGNLQVCAM
ASAKLNTLLQTKVIENQDEACYILGKLEHVLSQSIKEQTEIYSFLIPLVRTLVSKIYELL
FMNLHLPSLPFTNGSSSFFEDFQEYCSSNEWQVYIEKYIVPYMKQYETHTFYEGHEDMAV
YWKNCYEALMVNMHKRDREGGESKLKFQEFFVEPFNRKARQENLRYNNTVKQLSSQQLIT
LRRWKAVHLYLTSERGPWAKRKQSPIHWKLANVENYSRMRLKLVPNYNFKTHEDASALRD
NLGIQHSQPSSDSLLLEVVKQVKVSNMEEDKLDLPEDDLTARANIDEKEEQDQKEKLVLS
EDCELITIIDVIPGRLEITTQHVYFYDCSIDKEDGVGFDFKWPHSQIREIHLRRYNLRRS
ALEIFHVDQSNYFLNFKKEVRNKVYSRLLSLHSPISSGTRSPQELFKASGLTQKWVNREI
SNFDYLIQINTMAGRTYNDLAQYPVFPWILQDYTSEELDLNNPSVFRDLSKPIGVVNDKN
AKAMREKYENFEDPMGTIDKFHYGTHYSNSAGVMHYLIRTEPFTTLHIQLQSGRFDCADR
QFHSIPATWQALMDNAYDVKELIPEFFYFPEFLENQNQFNLGCLQVSKEVVNDVILPKWA
KSAEDFIYKHRKALESEYVSAHLHEWIDLIFGYKQRGPAAVEALNVFYYCSYEGAVDLDA
LTDEKERKALEGMINNFGQTPCQLLKEPHPPRLSAEEAVQKQTKTDTSTLNVFQHLSELK
SFFIEGISDGVPLIKAVVPKNQSRSFMSQGSPELLITVNMNYIVGTHGWLPYDRNISNYF
TFIKDQTVTNPKTQRIMNGPFAPGLEITSKLFIVSHDAKLLFSAGHWDNSIQVMSLTKGK
IISHNIRHMDIVTCLATDYCGIHLISGSRDTTCMIWQITQQGGVPVGLASKPFQILYGHT
DEVLSVGISTELDMAVSGSRDGTVIIHTIQKGQYMRTLRPPSESSVLLTVPNLAISWEGH
IVIYSSIEEKTNLKDKNALHLFSINGKYLGSQVLTEQVSDICITGEHIITGSLQGFLSIR
NLHSLNLSMNPLAMRMPIHCVCVTKEYSHILVGLEDGKLIVVGVGKPAEMRSGQLSRKLW
GSSKRLSQISAGETEYNTQDFK
Download sequence
Identical sequences M3XMT3
XP_004764256.1.14098 ENSMPUP00000000383 ENSMPUP00000000383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]