SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000401 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000401
Domain Number 1 Region: 1-116
Classification Level Classification E-value
Superfamily ENTH/VHS domain 4.45e-37
Family VHS domain 0.00044
Further Details:      
 
Domain Number 2 Region: 163-236
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-21
Family SH3-domain 0.0000553
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000000401
Domain Number - Region: 273-337
Classification Level Classification E-value
Superfamily GAT-like domain 0.0968
Family GAT domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000401   Gene: ENSMPUG00000000404   Transcript: ENSMPUT00000000409
Sequence length 497
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896909.1:6742326:6777560:-1 gene:ENSMPUG00000000404 transcript:ENSMPUT00000000409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDICDKVGSTPNGAKDCLKAIMKRVNHKVPHVALQALTLLGACVANCGKIFHLEVCSRDF
ATEVRAVIKNKAHPKVCEKLKSLMVEWSEEFQKDPQFSLISATIKSMKEEGITFPPAGSQ
TVSAAAKNGTSSNKNKEDEDIAKAIELSLQEQKQQHAETKSLYPSAEIQLNNKVARKVRA
LYDFEAVEDNELTFKHGEIIIVLDDSDANWWKGENHRGIGLFPSNFVTTNLNIESEAAAV
DKLNVIDDEEEEIKKSEPEPVYIDEDKMDRALHVLQSIDPTDSKPDSQDLLDLEDICQQM
GPMIDEKLEEIDRKHSELSELNVKVLEALELYNKLVNEAPVYPVYSKLHPPAHYPPSSTG
IPMQTYPVQSHGGNYMGQGIHQVTVPQSYSIGPDHIGPLRSLPPNVNSSMTTQPAQTPYL
STGQDTVSNPAYMNQNSNLQSAAGTAAYTQQMGMSVDMSSYQNATSSSLPQLAGFPVAVP
AHSVAQQQTNYHQQPLL
Download sequence
Identical sequences M3XMV1
ENSMPUP00000000401 ENSMPUP00000000401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]