SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000402 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000402
Domain Number 1 Region: 262-363
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.53e-30
Family Ras-binding domain, RBD 0.005
Further Details:      
 
Domain Number 2 Region: 399-511
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-16
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000402   Gene: ENSMPUG00000000405   Transcript: ENSMPUT00000000410
Sequence length 1226
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897001.1:2443295:2540772:-1 gene:ENSMPUG00000000405 transcript:ENSMPUT00000000410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQLSDEEIDHGAEEDSDKEDQDLDKMFGAWLGELDKLTQSLDSDKPMEPVKRSPLRQET
NMANFSYRFSIYNLNEALNQGETVDLDALMADLCSIEQELSSIGAGSSKRQITETKATQK
LPASRHTSKHGTLKGLSSSSNRITKPSHANYSLDDITAQLEQASLSMDEAAQQSVLEDTK
PSVTNQHRRTASAGTVSDAEVRSISNSSRSSITSATSSMDSLDIDKVTRPQELNLTHQGQ
PITEEEQAAKLKAEKIRVALEKIKEAQVKKLVIRVHMSDDSSKTMMVDERQTVRQVLDNL
MDKSHCGYSLDWSLVETISELQMGTERIFEDHENLVENLLNWTRDSQNKLIFMERIEKYA
LFKNPQNYLLGKKETAEMADRNKEVLLEECFCGSSVTVPEIEGVLWLKDDGKKSWKKRYF
LLRASGIYYVPKGKAKVSRELVCFLQLDHVNVYYGQDYRNKYKAPTDHCLVLKHPQIQKK
SQYIKYLCCDDMRTLHQWVNGIRIAKYGKQLYMNYQDALKRTESAYDWTSLSSSSIKSGS
SSSSIPESQSNHSNQSDSGVSDTQPAGHVRSQSIVSSIFSEAWKRGTQLEESSKKKKKIS
SVPWVSLLLFYSLIRTLSGPYFGILTLTSLQKQKHSPMRIIPSPFPYLISWDETALSGAN
NCIPMLTMYIFLARTVPCRSHSLSVLTPPVFLLLPQPQVPNEKASTAKVCIPAAARTGSS
KANVKNAPPLPALLDFCACWMQVSHTNTSVCVKLIHSCVTVHALLNILVFLTCPLASVTK
PSSFLRRPSASTPKPTYGICLVWMQPWTEGPHPRLPQSGGEAVHRGPPAGALVTGRCARR
LRSQAAHHRQSRHLRALPGGPTPCAFVARDPTFTFLTWFHCWILSRTSQISCCLAERSQS
LPPAPAPAPAPLPLTATPPASASDKSGSPGKKTSKTCSPGAKKPPPTPQRNSSIKSSSGA
EQPEPKRPSVDSLVSKFASPAEPSGSPSRETQSPPAAPPKPGKLNLSGVHLPGILQQGCA
SAKASALGGRGKGSAAEFPSPPSDSDFPPPPPEIELPLPPVEIPAVFSGNTSPKVAVVNP
QPQPWSKTSTKKAPPPTRPRRNDSTRLTQAEVSEQPATAAVVVPQVPTSPKSSLSVQPGF
LADLNRTLQRKSVTRHGSLSSARTSRAEPTATMDDMALPPPPPELLSEPQKAGFGGGHIA
GYATLRRGPPPAPPKRDQSTKLSRDW
Download sequence
Identical sequences M3XMV2
ENSMPUP00000000402 ENSMPUP00000000402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]