SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000404 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000404
Domain Number 1 Region: 97-227
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.67e-30
Family DEP domain 0.0000364
Further Details:      
 
Domain Number 2 Region: 221-350
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.62e-26
Family cAMP-binding domain 0.0000033
Further Details:      
 
Domain Number 3 Region: 348-450
Classification Level Classification E-value
Superfamily Ras GEF 0.000000000000445
Family Ras GEF 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000404   Gene: ENSMPUG00000000407   Transcript: ENSMPUT00000000412
Sequence length 466
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897011.1:6346317:6357468:-1 gene:ENSMPUG00000000407 transcript:ENSMPUT00000000412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVGWPGESRWQVGLAVDDTPSLGAAQVGGLPDVVPEGTLFNMVLKRVHRPRSCSYQLLL
EHQRPSRIQGLRWTPLTDSEESLDFSVSLEQASAERVLRAGKQLHRHLLATCPTLIRDRK
YHLRLYRQCCSGRELVDGILALGLGVQSRSQAVGICQVLLDEGALYHVKHDWTFQDRDTQ
FYRFPGPEPETAGVRELEEELVEAVALLSQRGPDALLTVALRKPPGQRTDEELDLIFEEL
LHIKAVAHLSNSVKRELAAVLLFEPHSKAGTVLFSQGDKGTSWYIIWKGSVNVVTHGKGL
VTTLHEGDDFGQLALVNDAPRAATIILREDNCHFLRVDKQDFNRIIKDVEAKTMRLEEHG
KVVLVLERASQGAGPSRPPTPGRNRYTVMSGTPEKILELLLEAMRPDSSTHDPTETFLSD
FLLTYSVFMPSAQLCAALLHQYPSSSRGDKEVVQNREKGSLPAGLS
Download sequence
Identical sequences M3XMV4
ENSMPUP00000000404 ENSMPUP00000000404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]