SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000409 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000409
Domain Number 1 Region: 357-420
Classification Level Classification E-value
Superfamily FF domain 4.06e-18
Family FF domain 0.0000204
Further Details:      
 
Domain Number 2 Region: 716-778
Classification Level Classification E-value
Superfamily FF domain 0.00000000000157
Family FF domain 0.0000219
Further Details:      
 
Domain Number 3 Region: 118-152
Classification Level Classification E-value
Superfamily WW domain 0.00000000000264
Family WW domain 0.00033
Further Details:      
 
Domain Number 4 Region: 575-647
Classification Level Classification E-value
Superfamily FF domain 0.00000000000314
Family FF domain 0.0043
Further Details:      
 
Domain Number 5 Region: 492-567
Classification Level Classification E-value
Superfamily FF domain 0.00000000000693
Family FF domain 0.0042
Further Details:      
 
Domain Number 6 Region: 149-187
Classification Level Classification E-value
Superfamily WW domain 0.00000000118
Family WW domain 0.0015
Further Details:      
 
Domain Number 7 Region: 425-494
Classification Level Classification E-value
Superfamily FF domain 0.000000034
Family FF domain 0.004
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000000409
Domain Number - Region: 40-88
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0575
Family beta-sandwich domain of Sec23/24 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000409   Gene: ENSMPUG00000000412   Transcript: ENSMPUT00000000417
Sequence length 930
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896909.1:7270649:7324480:-1 gene:ENSMPUG00000000412 transcript:ENSMPUT00000000417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSGSGRGRSSLSPTMRPGTGAERGGLMMGHPGMHYAPMGMHPMGQRANMPPVPHGMMPQ
MMPPMGGPPMGQMPGMMSSVMPGMMMSHMSQASMQPALPPGVNNMDVAAGTASGAKSMWT
EHKSPDGRTYYYNTETKQSTWEKPDDLKTPAEQLLSKCPWKEYKSDSGKPYYYNSQTKES
RWAKPKELEDLEGYQNTIVAGSLITKSNLHAMIKAEESSKQEECTTTSAAPVPTTEIPTT
MSTMAAAEAAAAVVAAAAAAAAAAAAANASASTSASNTVGGTGPVVPEPEVTSIVATVVD
NENTVTISTEEQAQLTSTPAVQEQSMEVSSNTGDETAKQETVADFTPKKEEEESQPAKKT
YTWNTKEEAKQAFKELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQ
TEKEEKEEARSKYKEAKESFQRFLENHEKMTSTTRYKKAEQMFGEMEVWNAISERDRLEI
YEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYSTTWSEAQQYLMDNPTFAEDE
ELQNMDKEDALICFEEHIRALEKEEEEEKQKSLLRERRRQRKNRESFQIFLDELHEHGQL
HSMSSWMELYPTISSDIRFTNMLGQPGSTALDLFKFYVEDLKARYHDEKKIIKDILKDKG
FVVEVNTTFEDFVAIISSTKRSTTLDAGNIKLAFNSLLEKAEAREREREKEEARKMKRKE
SAFKSMLKQATPPIELDAVWEDIRERFVKEPAFEDITLESERKRIFKDFMHVLEHECQHH
HSKNKKHSKKSKKHHRKRSRSRSGSDSDDDDSHSKKKRQRSESRSASEHSSSAESERSYK
KSKKHKKKSKKRRHKSDSPESDAEREKDKKEKDRESEKDRTRQRSESKHKSPKKKTGKDS
GNWDTSGSELSEGELEKRRRTLLEQLDDDQ
Download sequence
Identical sequences M3XMV9
ENSMPUP00000000409 ENSMPUP00000000409 XP_004743928.2.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]