SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000429 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000429
Domain Number 1 Region: 288-398
Classification Level Classification E-value
Superfamily PDZ domain-like 3.94e-27
Family PDZ domain 0.0026
Further Details:      
 
Domain Number 2 Region: 408-521
Classification Level Classification E-value
Superfamily PDZ domain-like 7.36e-26
Family PDZ domain 0.00000484
Further Details:      
 
Domain Number 3 Region: 111-219
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-17
Family PDZ domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000429   Gene: ENSMPUG00000000432   Transcript: ENSMPUT00000000437
Sequence length 1129
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897001.1:3780573:4491086:1 gene:ENSMPUG00000000432 transcript:ENSMPUT00000000437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLIAVFDEQEPLHKIESPSGNPAGRQSPDAFETEVAAQLAAFKPIGREIEVTPSALKLGT
PLLVRRSSDPAPGPPADAQPRASHPSGQSLKPVILDSTQNLEDEEVMNGVQTEPLTSLKT
KAALSDMTRTVEISGEGGPLGIHVVPFFSSLSGRILGLFIRGIEENSRSKREGLFHENEC
IVKINSVDLVDKTFAQAQDVFRQAMKSPSVLLHVLPPQNREQYEKSVIGSLNIFGNNDGV
LRTKPQPPVHGIAGIKTVTLTGTGGPEEDALTSLQQSKSPRVPRLGRKPSSPSLSPLMGF
GSKKNAKKIKIDLKKGPEGLGFTVVTRDSSIHGPGPIFVKNILPKGAAIKDGRLQSGDRI
LEVNGRDVTGRTQEELVAMLRSTKQGETASLVIARQEGTFLPRELKGEPDCYALSLETTE
QLTFEIPLNDSGSAGLGVSLKGNKSRETGTDLGIFIKSIIHGGAAFKDGRLRMNDQLIAV
NGESLLGKSNHEAMETLRRSMSMEGNIRGMIQLVILRRPERPLEEPAECGAFSKPCFENC
QNTITTSRRNDNSSLHPFGTYSSQDKQKVLLLPSDGWADPEVPPSPPPHPVLELGLEDYS
HSSGVDSVAYFPDQHIHFRSVTPARQPESMNLKASKSMDLVSDESKVHSLAAHKSDSPSK
DFGPTLGLKKSSSLESLQTAVAEVRKNELPFHRPRPHMVRGRGCNESFRAAIDKSYDGPE
ELEADGLSDKSSHSGQGALSCESVPQGSPELEDGEQKARKIKKPKEKEKKKEKGKLKAKE
KKLKEENEDPERKIKKKGFGAMLRFGKKKDDRGGKTEQKGSLKHGALTGEEREKMKERER
IVAKHQELREKQARGLLDSAAGATGSLHDMDDDEMDPNYARVNHFREPCASSVYRSPSPP
RAGPLGYHRESRPLSPERDHLEGLYAKVNKPYHPLVPAESGRPASGSTDRIQKLRKEYYQ
ARREGFTLYEDDEGRARLDYDLHWVSGKGPDGNAHNVRFEGMERQYASLPRGGPADPVDY
LTATPRALYQERELPYYPGVHPVRPPKGSYPRPPDLRVADLRYPQYYPPPPAPQHKGPFR
QDVPPSPPQQHRVPANPEMGRPGPRGGSPDQYPYRAQDPRQKSPMTAAV
Download sequence
Identical sequences M3XMX9
ENSMPUP00000000429 ENSMPUP00000000429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]