SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000435 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000435
Domain Number 1 Region: 334-596
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.3e-72
Family Nuclear receptor ligand-binding domain 0.000000000109
Further Details:      
 
Domain Number 2 Region: 261-339
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.36e-28
Family Nuclear receptor 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000435   Gene: ENSMPUG00000000438   Transcript: ENSMPUT00000000443
Sequence length 598
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896909.1:10304104:10310914:-1 gene:ENSMPUG00000000438 transcript:ENSMPUT00000000443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSF
STFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSV
YYKPSSPPTPTTPGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQ
SPPGTPVSSCQMRFDGPLHVPMNPEQAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHA
SQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCL
ANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSP
PVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGW
AEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFG
EWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVT
FNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF
Download sequence
Identical sequences D2HUI7 M3WFK9 M3XMY5
ENSMPUP00000000435 XP_004743941.1.14098 XP_004743942.1.14098 XP_005640246.1.84170 XP_006935356.1.62641 XP_011231968.1.58354 XP_011231969.1.58354 XP_012907396.1.14098 XP_013966340.1.84170 XP_019312247.1.44245 XP_019312255.1.44245 XP_019662576.1.58354 XP_019662577.1.58354 XP_019662578.1.58354 XP_019693681.1.62641 XP_535920.2.84170 9615.ENSCAFP00000013553 ENSAMEP00000010319 ENSAMEP00000010319 ENSFCAP00000010857 ENSMPUP00000000435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]