SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000437 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000437
Domain Number 1 Region: 55-181,212-329
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.36e-43
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.069
Further Details:      
 
Domain Number 2 Region: 619-693
Classification Level Classification E-value
Superfamily EF-hand 2.68e-17
Family Calmodulin-like 0.02
Further Details:      
 
Domain Number 3 Region: 310-404
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.000000687
Family D-aminoacid oxidase-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000437   Gene: ENSMPUG00000000440   Transcript: ENSMPUT00000000445
Sequence length 727
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896909.1:10439521:10540281:1 gene:ENSMPUG00000000440 transcript:ENSMPUT00000000445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFQKAVKGTILVGGGALASVLGLSQFAHYRRKQVSLAYVEAAECVTEPVNREPPSREAQ
LLTLQNMSEFDILVIGGGATGCGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVR
YLQKAIMKLDIEQYRMVKEALHERANLLEIAPHLSAPLPIMLPIYKWWQLPYYWVGIKLY
DLVAGSNCLKSSYVLSKSRALEHFPMLQKDKLVGAIVYYDGQHNDARMNLAIALTAARYG
AATANYMEVVSLLKKTDPHTGKERVSGARCKDVLTGQEFDVRAKCVINATGPFTDTVRKM
DDKNATAICQPSAGVHIVMPGYYSPESMGLLDPATSDGRVIFFLPWQKMTIAGTTDTPTD
VTHHPIPSEEDINFILNEVRNYLSCDVEVRRGDVLAAWSGIRPLVTDPKSADTQSISRNH
VVDISESGLITIAGGKWTTYRSMAEDTINAAIKAHNFKAGPSRTVGLFLQGGKDWSPTLY
IRLVQDYGLESEVAQHLAATYGDKAFEVAKMASVTGKRWPIVGVRLVSEFPYIEAEVKYG
IKEYACTAVDMISRRTRLAFLNVQAAEEALPRIVELMGRELNWDDFKKEEELETARKFLY
YEMGYKSRSEQLTDRSEISLLPSDIDRYKKRFHKFDADQKGFITIVDVQRVLESINVQMD
ENTLHEILNEVDLNKNGQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVPIPV
DRSCGGF
Download sequence
Identical sequences M3XMY7
XP_004743946.1.14098 ENSMPUP00000000437 ENSMPUP00000000437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]