SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000438 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000438
Domain Number 1 Region: 340-749
Classification Level Classification E-value
Superfamily Phosphofructokinase 4.97e-110
Family Phosphofructokinase 0.00000763
Further Details:      
 
Domain Number 2 Region: 16-339
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.96e-105
Family Phosphofructokinase 0.000000311
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000438   Gene: ENSMPUG00000000441   Transcript: ENSMPUT00000000446
Sequence length 782
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897011.1:6704202:6728047:1 gene:ENSMPUG00000000441 transcript:ENSMPUT00000000446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVD
GGDHIREATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAHNLVKRGITNLCVIGGDG
SLTGADTFRSEWSDLLSDLQKAGKITAEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDS
ALHRIIEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWE
EHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGYDTRVTVLGHVQ
RGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTK
AMNDRKFDEAMKLRGRSFMNNWEVYKLLAHVRPPVTKAPGSTHTVAVMNVGAPAAGMNAA
VRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSF
EQISANITKFNIQGLVIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATVSNNVPGSDF
SVGADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEE
PFTIRDLQANVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNV
LGHMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRAL
VFQPVTELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSEHAHLEHISRKRSGET
SI
Download sequence
Identical sequences M3XMY8
XP_004765693.1.14098 XP_004765694.1.14098 XP_004765695.1.14098 XP_012918462.1.14098 ENSMPUP00000000438 ENSMPUP00000000438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]