SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000449 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000449
Domain Number 1 Region: 3-285
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.28e-68
Family Protein kinases, catalytic subunit 0.0000793
Further Details:      
 
Domain Number 2 Region: 571-635
Classification Level Classification E-value
Superfamily DEATH domain 2.66e-18
Family DEATH domain, DD 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000449   Gene: ENSMPUG00000000454   Transcript: ENSMPUT00000000459
Sequence length 646
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896938.1:1908589:1948610:1 gene:ENSMPUG00000000454 transcript:ENSMPUT00000000459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLDDIKMKTSDLLEKEYLDSGGFGKVSLCLHRCHGLVILKKVYTGPKRTEYNESLLEEG
KMMHRLRHSRVVKLLGVIIEEGNYSLVMEYMEKGNLMHVLKAEVSIPLSLKGRIIMEIIE
GMCYLHGQGIIHKDLKPENILVDDDFHIKIADLGVASFKMWSKLTKEEHNEQRKLNRVSK
KNGGTLCYMAPEHLNDINAKPSEKSDVYSFGIVLWAIFANKEPYENAICEEQLIICIKSG
NRPNVEDILEYCPEEIISIMKQCWEAKPDIRPTFIGLEEKFRPFYVDQLEENVEDDVTSL
KKQYPDPDQSSFVKRMHSLQIDCTAIPPSRSNSAPEQPSSLHSSQGLGIGPVEESWFAPS
LENQQEENQLSLQSKLQEEANYHLHGSRMDRQTKPLRQNVIYNREEERRRRVSHDPFAQP
KPYENVQNPGVGLPYSSATSPGNALHQPTGPTSQPQVLYWNNGLNNPFSFGTRPQDLGAA
SSRAWYGPNPNHMPSVHKTPVPETNLLGNTATLSFGSFPSRDESVKCSIRNSAGIQIGDH
NYMEISGMSSVPLDMNFKEEPAAKYHDIFENITSLTDKHLDPVRENLGKQWKNCARKLGF
TEPQIDEIDHDYERDGLKEKVYQMLQKWQMREGQPCLYCSRNSNGQ
Download sequence
Identical sequences M3XMZ9
ENSMPUP00000000449 ENSMPUP00000000449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]