SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000480 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000480
Domain Number 1 Region: 3-308
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.16e-63
Family WD40-repeat 0.00045
Further Details:      
 
Domain Number 2 Region: 389-473
Classification Level Classification E-value
Superfamily RING/U-box 1.84e-24
Family U-box 0.0019
Further Details:      
 
Domain Number 3 Region: 329-396
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000157
Family SAM (sterile alpha motif) domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000480   Gene: ENSMPUG00000000486   Transcript: ENSMPUT00000000491
Sequence length 475
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896909.1:12855482:12902698:-1 gene:ENSMPUG00000000486 transcript:ENSMPUT00000000491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKLIHTLADHGDDVNCCAFSSSLLATCSLDKTIRLYSLSDFTELPHSPLKFHTYAVHCC
CFSPSGHVLASCSTDGTTVLWNTQNGETLAVMEQPTGSPVRVCQFSPDSTCLVSGAADGT
VVLWNAQSYKLYRCGSVKDGSLVACAFSPNGNLFVTGSSCGDLTVWDDKMRCLHSEKAHD
LGITCCDFSSQPVTDGEHGLQFFRLASCGQDCQIKIWVVSFTHVLGFELKYKSTLNGHCA
PVLACAFSHNGQMLVSGSVDKSVIIYDTNTESILHTLTQHTRYVTSCAFAPSTPLLATGS
MDKTVNIWQFDLETPCQARSMEDQVKFTEDWSEEDVSVWLCAQGLSDLVAIFKMNNIDGR
ELLNLTKESLADDLKIESLGLRSKVLRKIEELRTKVKTLSSGIPDEFLCPITRELMKDPV
IASDGYSYEKEAMENWISKKKRTSPMTNLVLPSVVLTPNRTLKMAISRWLETHQK
Download sequence
Identical sequences M3XN30
ENSMPUP00000000480 ENSMPUP00000000480 XP_004743970.1.14098 XP_004743971.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]