SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000486 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000486
Domain Number 1 Region: 353-480
Classification Level Classification E-value
Superfamily PH domain-like 4.56e-24
Family Pleckstrin-homology domain (PH domain) 0.0029
Further Details:      
 
Domain Number 2 Region: 204-314
Classification Level Classification E-value
Superfamily PH domain-like 4.2e-17
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000000486
Domain Number - Region: 506-524,671-722
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0184
Family Di-heme elbow motif 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000486   Gene: ENSMPUG00000000492   Transcript: ENSMPUT00000000497
Sequence length 758
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897001.1:6459804:6639015:-1 gene:ENSMPUG00000000492 transcript:ENSMPUT00000000497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEALEVDDISPALEVTEDFFSTFDSKLEKAVQQAEVYGIQEVPELVGHEVLTNITDNGAI
RHVASLGKGGLLWDHCKSRLLETKAQNVFPAKEQFMVQKGTAPDNLSWMEQKEASTFNFF
NVCQRRRDRPRSVNDLLDETSTFKPGHARSRSDVTQVDWRLVLQTMPLEQQPPCLRGPHF
ARPAFLSSSPNKVEDAQGNTEHKQAFPNILKKGYLEIRKDHDSYWQSCYAELSPYNLYFY
SLDSSGNQALYATYQLSHFQSISVLGNLEARLVDTVLYDNTQLQLKAESPWEALDWGQKL
WEVVHAAVPGYVGRQDELANSPGLGHHVDCTQNHCLQKKSSELLTPSPVLDSPKQYENII
KSGTLYRLTVQNNWKAFTFVLSRTYLMAFQPGKLDEDPLLSYHVDVCLAVQVDNLDDCDS
CFQVIFPQDVLRLRAETRQRAEEWMEALKTAANVARSTEQNLQVTLRSKPKDQMGGHELR
KNKRQSVTTSFLSILTTLSLERGLTAQSFKCAGCQRSIGLSSGKAKVCSYSGWYYCSGCH
VDDSFLIPARIVHNWDTSKYKVSKQAKEFLEYVYEEPLIDIQQENPMLYLHAEPLATVVR
LRQRLKSLRAYLFSCRAAVAEDLRRRIFPREYLLQQIHLYSLADLQQVIEGKLAPFLGKV
IKFATSHVYSCSLCSQKGFICEICNNGEILYPFEDISTSRCESCGAVFHSECKEKSVPCP
RCVRRELQKKQKSFWRRLNMDESLEEAGNMFELSYQNT
Download sequence
Identical sequences M3XN36
ENSMPUP00000000486 ENSMPUP00000000486 XP_004764323.1.14098 XP_012917754.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]