SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000498 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000498
Domain Number 1 Region: 95-274
Classification Level Classification E-value
Superfamily ADP-ribosylation 3.96e-40
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000498   Gene: ENSMPUG00000000505   Transcript: ENSMPUT00000000510
Sequence length 322
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896964.1:4450481:4470536:1 gene:ENSMPUG00000000505 transcript:ENSMPUT00000000510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPGGWAAVKEVAGRDVLAADLRCSLFASALQSYKRDSVLRPFPASYARHDCKDFEALLA
DASKLPNLKELLQSSGDKDVRARDLVSWILSSKVLTIHSAGKSEFEKIQKLTGAPHTPVP
VPDFLFEIEYSNPANAKFYETKGERDLIYAFHGSRLENFHSIIHNGLHCHLNKTSLFGEG
TYLTSDLSLALIYSPHGLGWQRSLLGPILSCVAVCEVIDHPDVKCQMKKKDSKEMDRRRA
RIKHSEGGDVPPKYFVVTNNQLLRVKYLLVYSQRQPSRASSQLSWFSSHWFMVMISLYLL
LLLIVSAINSSAFHHFWNRAKR
Download sequence
Identical sequences M3XN48
ENSMPUP00000000498 XP_004758726.1.14098 XP_004758727.1.14098 XP_012914973.1.14098 ENSMPUP00000000498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]