SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000514 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000514
Domain Number 1 Region: 1802-2085
Classification Level Classification E-value
Superfamily SAICAR synthase-like 1.24e-77
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.00042
Further Details:      
 
Domain Number 2 Region: 678-844
Classification Level Classification E-value
Superfamily GroEL apical domain-like 2.28e-40
Family Group II chaperonin (CCT, TRIC), apical domain 0.00053
Further Details:      
 
Domain Number 3 Region: 354-485
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.99e-29
Family DEP domain 0.0038
Further Details:      
 
Domain Number 4 Region: 155-227
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.2e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0036
Further Details:      
 
Domain Number 5 Region: 631-684,837-857
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 0.000014
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.046
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000000514
Domain Number - Region: 1459-1515
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0272
Family Spectrin repeat 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000514   Gene: ENSMPUG00000000520   Transcript: ENSMPUT00000000526
Sequence length 2099
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897001.1:6811417:6886911:1 gene:ENSMPUG00000000520 transcript:ENSMPUT00000000526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATDDKASPAVDSANDLPRSPTSPSHLTHFKPLTPDQDEPPFKSAYSSFVNLFRFNKERA
EGVQGEQQPLAGSWASPQLPSRTQSVRSPTPYKKQLNEELQRRSSAVLDTRRKAEPTFGG
HDPRTAVQLRSLSTVLKRLKEIMEGKSQDSDLKQYWMPDSQCKECYDCSEKFTTFRRRHH
CRLCGQIFCSRCCNQEIPGKFMGYTGDLRACTYCRKIALSYAHSTDSNSIGEDLNALSDS
ASSVSVLDPSEPRTPVGSRKASRNIFLEDDFAWQSLIHPDPSNTPLSTRLVSVQEDAGKS
PARNRSASITNLSLDRSGSPMVSSYETSVSPQANRTYVRTETTEDERKILLDSVQLKDLW
KKICHHSSGMEFQDHRYWLRTHPNCIVGKELVNWLIRNGHIATRAQAIAIGQAMVDGRWL
DCVSHHDQLFRDEYALYRPLQSTEFSETPSPDSDSVNSVEGHSEPSWFKDIKFDDSDTEQ
IAEEGDDNLTNSASPSKRTSVSSFQSTVDSDSAASISLNVELDNVNFHIKKPSKYPHVPP
HPADQKEYLISDNGGQQLSISDAFIKESLFNRRVEEKSKELPFTPLGWHHNNLELLREEN
GEKQAMERLLSANHNHMMALLQQLLHNESLSPSWRDIIVSLVCQVVQTVRPDVKNRDDDM
DIRQFVHIKKIPGGKKFDSVVVNGFVCTKNIAHKKMNSCIKNPKILLLKCSIEYLYREET
KFTCIDPIVLQEREFLKNYVQRIVDVRPTLVLVEKTVSRIAQDMLLEHGITLVINVKSQV
LERISRMTQGDLVMSMDQLLTKPHLGTCHKFYMQMFQLPSEQTKTLMFFEGCPQHLGCTI
KLRGGSDYELARVKEILIFMICVAYHSQLEISFLMDEFAMPPTLTQNPSFHSLIEGQEDE
GTAQEPSSASPLTREPDFPAELLPSEDGSLLESRTVFEKGDQENKSVTQDAASLKHQEYA
TTACAAGIPCALFPSVPESLLPLHVDDRQDALGMEQPEPLQHADELQDPKSQMRTFRDPL
QDDTGLYVTEEVTSSEDKRKTYSLAFKQELKDVILCISPVITFREPFLLTEKGMRCSTRD
YFAEQVYWSPLLNKEFKEMESRRKKQLLRDLSGLQGMNGSVQAKSIQVLPSHELVSTRIA
EHLGDSQSLGRMLADYRARGGRIQQKNADPFAYSKEVPGTASGRSGSRIEGDEEKGLIPN
DAVWSTKVDCLNPVNHQRLCVLFSSSSAQSSNAPSACVSPWIVTMEFYGKNDLTLGIFLE
RYCFRPSYQCPSMFCDTPMVHHIRRFVHGQGCVQIILKELDSPVPGYQHTILTYSWCRIC
KQVTPVVALSNESWSMSFAKYLELRFYGHQYTRRANAEPCGHSIHHDYHQYFSYNQMVAS
FSYSPIRLLEVCVPLPKIFIKRQAPLKVSLLQDLKDFFQKVSQVYLAVDERLASLKTDTF
SKTREEKMEDIFAQKEMEEGEFKNWIEKMQARLMSSSVDTPQQLQSVFESLIAKKQSLCE
VLQAWNNRLQDLFQQEKGRKRPSVPPSPGRLRQGEESKISAMDAAPRNISPGLQNGEKED
RFLTTLSSQSSTGSTHLQLPTPPEVMPEQLGAGPADLDTASSSEDVFDGHLLGSTDSQVK
EKSTMKAIFANLLPGNSYNPIPFPFDPDKHYLMYEHERVPIAVCEKEPSSIIAFALSCKE
YRNALEELSKATQRSSAEEGLPTNSTLDSRPKSSSPIRLPEVSGGQTNRTAEAEPQPTKK
ASGMLSFFRGTAGKSPDLSSQKRETLRGADSAYYQVGQTGKEGTESQGIEPQDEVDGGDT
QKKQLINPHVELQFSDANAKFYCRLYYAGEFHKMREVILGSSEDDFIRSLSHSSPWQARG
GKSGAAFYATEDDRFILKQMPRLEVQSFLDFAPHYFNYITNAVQQKRPTALAKILGVYRI
GYKNSQNNTEKKLDLLVMENLFYGRKMAQVFDLKGSLRNRNVKTDTGKESCDVVLLDENL
LKMVRDNPLYIRSHSKAVLRASIRSDSHFLSSHLIIDYSLLVGRDDTSNELVVGIIDYIR
TFTWDKKLEMVVKSTGILGGQGKMPTVVSPELYRTRFCEAMDKYFLMVPDHWTGLGLNC
Download sequence
Identical sequences M3XN64
ENSMPUP00000000514 XP_004764334.1.14098 XP_004764335.1.14098 XP_004764336.1.14098 ENSMPUP00000000514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]