SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000540 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000540
Domain Number 1 Region: 192-502
Classification Level Classification E-value
Superfamily Cysteine proteinases 9.25e-117
Family Transglutaminase core 0.000000000022
Further Details:      
 
Domain Number 2 Region: 9-191
Classification Level Classification E-value
Superfamily E set domains 2.03e-56
Family Transglutaminase N-terminal domain 0.000000014
Further Details:      
 
Domain Number 3 Region: 517-628
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 4.71e-32
Family Transglutaminase, two C-terminal domains 0.0000027
Further Details:      
 
Domain Number 4 Region: 630-727
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.83e-27
Family Transglutaminase, two C-terminal domains 0.00000279
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000540   Gene: ENSMPUG00000000546   Transcript: ENSMPUT00000000552
Sequence length 732
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896938.1:4909696:5073100:-1 gene:ENSMPUG00000000546 transcript:ENSMPUT00000000552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSETSEPAFGGRRALPRNASNAAEDDLPTVELQGLVPRGVNLQDYLHVTSVHLFKERWDT
NKVDHHTDKYENNKLIVRRGQSFFIQIDFNRPYDPRRDLFRVEYVIGRYPQENKGTYIPV
PIVPELQKGKWGAKVVMREDRSVRLSIQSSPECIVGKFRMYVAVWTPYGILRTSRNPETD
TYILFNPWCEEDAVYLGDEKEKEEYVLNDIGVIFYGDFNDIKSRSWSYGQFEDGILDACL
YVMDKAEMDLSGRGNPIKVSRVGSAMVNAKDDEGVLVGSWDNVYAYGVPPSAWTGSVDIL
LEYQSTKNPVRYGQCWVFAGVFNTFLRCLGIPARVVTNYFSAHDNDANLQMDIFLEEDGN
VNSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAVDSTPQENSDGMYRCGPASVQAIKH
GHICFQFDAPFVFAEVNSDLIYVTAKKDGTHVVEAVDTAHIGKMIVTKEVGGDGIKDITD
TYKFQEGQEEERLALETALMYGAKKPINTDGILKPRSDVTMNFEVENAVLGRDFKLTITF
QNNSHNRYTLSAYLSGNVVFYTGVSKTEFKKEAFEVTLEPLSLKKEEVLIRAGEYMSQLL
EQAYLHFFVTARVNETKDVLAKQKSTMLIIPQLVIKVRGARMVGSDMVVTVEFTNPLKET
LRNVWIHLDGPGVLKPRRKMFREIQPNSTVQWEEVCRPWVSGHRKLIASMTSDALRHVYG
ELDLQIQRQPSE
Download sequence
Identical sequences M3XN90
ENSMPUP00000000540 XP_004753720.1.14098 XP_004753721.1.14098 ENSMPUP00000000540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]