SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000541 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000541
Domain Number 1 Region: 19-118
Classification Level Classification E-value
Superfamily PH domain-like 1.44e-18
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000541   Gene: ENSMPUG00000000547   Transcript: ENSMPUT00000000553
Sequence length 497
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896964.1:4837394:4858066:-1 gene:ENSMPUG00000000547 transcript:ENSMPUT00000000553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEEGVKEGGEKPRGARRADKAGWIKKSSGGLLGFWKDRYLLLCQAQLLVYENEDEQKCV
ETVELGSYEKCQDLRALLKRKHRFILQRSPGNKVSDIKFQATSGEEKESWIKALNEGINR
GKNKVFDEVKVDKSCALEHVTRDRVRGGQRRRPPTRVHLKEVANAASDGLLRLDLEVPDS
GPPVFAPSNDVSAAQPREILKPPMPPTKPSPAPETTSLGDSMETPAGEGAPSPVSASSES
HPGSQEDSETPEQDSGSEQPPNRVLPDKLKVSWENANPKDSPDFESTEIPVPCSETPEAV
PKEGGKPPTPPPKILSEKLRASVSRMEASGPAQSPEASETSAPDPAEISVNGMDDSPKPI
KPPQASGISKTTPEDATTPTALPRWDLPPHFHPRCSSLGDLLGEGPRRPRQPGERLYRAQ
LEVKVASEQTEKLLNKVLDSEPNPVNAETLLSQAVEQLRQATQVLQEIRDLDELSQEAPG
LKEKRKELVTIYRRSAP
Download sequence
Identical sequences M3XN91
ENSMPUP00000000541 XP_004758754.1.14098 ENSMPUP00000000541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]