SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000571 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000571
Domain Number 1 Region: 1571-1808
Classification Level Classification E-value
Superfamily Plakin repeat 3.05e-84
Family Plakin repeat 0.000000000583
Further Details:      
 
Domain Number 2 Region: 1329-1564
Classification Level Classification E-value
Superfamily Plakin repeat 8.2e-77
Family Plakin repeat 0.00000235
Further Details:      
 
Domain Number 3 Region: 1882-1922,1971-2165
Classification Level Classification E-value
Superfamily Plakin repeat 8.63e-69
Family Plakin repeat 0.00000000849
Further Details:      
 
Domain Number 4 Region: 796-924,951-978
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000257
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 5 Region: 287-416
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000166
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 6 Region: 1821-1875
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000000366
Family Plakin repeat 0.0052
Further Details:      
 
Domain Number 7 Region: 150-233
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000864
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000571   Gene: ENSMPUG00000000577   Transcript: ENSMPUT00000000583
Sequence length 2236
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896938.1:6226410:6272512:1 gene:ENSMPUG00000000577 transcript:ENSMPUT00000000583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYYSRRCTVTDQNSDGYCQTGTMSRHQNQNTIQELLQNCSDCLMRAELIVQPELKYGDGI
QLARSRELDECFAQANDQMEITDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISAP
RVRRASSKGGGGYTCQSGSGWDEFTKRVTSECLGWMRQQRAEMDMVAWGVDLASVEQHID
SHRSIHNAIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQAT
SREIMWINDCEEEELLYDWSDRNTNIAQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLN
QHPASDKIEAYMDTLQTQWSWILQITKCIDVHLKENAAYFQFFEEAQSTEAYLKGLQDSI
RKKYPCDKNMPLQRLLDQIKELEKEREKILEYKRQVQNLVNKSKKIVQLKPRNPDYRSNK
PIILRALCDYKQDQKIVHKGDECILKDNNERSKWYVTGPGGVDMLVPSVGLIIPPPNPLA
VDLSCKIEQYYEAILALWNQLYINMKSLVSWHYCMIDIEKIRAMTIAKLKTMRQEDYMKT
ISDLELHYQEFIRNSQGSEMFGDDDKRKMQSQFTDAQKHYQTLVIQLPGHPQHQTVTTTE
ITHTSCQDLNHNKVIETNRENDKQETWLLMELQKIRRQMEHCESRMTLKNMLLADQGSTH
HITVKINELKSVQNDSQAIAEVLNQLKDMLANFRGSEKYCYLQNEVFGLFQKLENINGVT
DGYLNSLCTVRALLQAILQTEDMLKVYEARLTEEETVCLDLDKVEAYRCGLKKIKNDLNL
KKSLLATMKTELQKAQQIHSQTSQQYPLYDLDLGKFSDKVTQLTDRWQKIDKQIDYRLWD
LEKQIKQLRNYRDNYQAFCKWLYDAKRRQDALESMKFGDSNTVMRFLNEQKNLHNEICGK
RDKSEEVQKIAELCANSIKDYELQLASYTSGLETLLNIPIKRTMVQSPSGVILQEAADIH
ARYIELLTRSGDYYRFLSEMLKSLEDLKLKNTKIEVLEEELRLARDANSENCNKNKFLDQ
NLQKYQAECSQFKAKLVSLEELKRQAELDGKSAKQNLDKCYGQIKELNEKITRLTYEIED
EKRRRKAVEDRFDQQKSDYDQLQKARQCEKESLGWQKMESEKAIKEKEYEIERLRVLLQE
EGARKREYENELAKASNRIQESKNQCTQVVQERESLLVKIKVLEQDKSRLQRLEDELNRL
KTALEAESRLKQRLECEKQQIQNDLNQWKTQYSRKEETIRKIESEREKSEREKNSFRSEI
ERLQAEIKRIEERYRRKLEDSTRETQSQLETERSRLQREIDRLKQRPYGSHRETQTEYEW
TVDSSKLVFDGLRKKVTAMQLYECQLIDKTTLDKLLKGKKSVEEVASEIQPFLRGAGAIA
GASASPKEKYSLVEAKRKKLITPESTVMLLEAQAATGGIIDPHRNEKLTVDNAIARDLID
FDDRQQIYTAEKAITGFDDPFSGKTVSVSEAIKKNLIDRETGMRLLEAQIASGGVVDPVN
SVFLPKDVALARGLIDRDLYRSLNDPRDSQKNFVDPVTKKKVSYMQLRERCRIEPHTGLL
LLSVQKRSMSFQGIRQQVTVSELVDSGILRPSTVNELESGQISYDEVGERIKDFLQGSSC
IAGIYNETTKQKLGIYEAMKIGLVRPGTALELLEAQAATGFIVDPVSNLRLPVEEAYKRG
LVGIEFKEKLLSAERAVTGYNDPETGNIISLFQAMNKELIEKGHGIRLLEAQIATGGIID
PKESHRLPVDMAYKRGYFNEELSEILSDPSDDTKGFFDPNTEENLTYLQLKERCIKDEET
GLCLLPLKEKKKEVQTSQKNTLRKRRVVIVDPETNKEMSVQEAYKKGLIDYETFRELCEQ
ECEWEEITITGSDGSTRVVLVDRKTGSQYDIQDAIDKGLIDRKFFDQYRSGSLSLTQFAD
MISLKNGVGNSSGIGGGVSDEVFSNSRHESVSKISTVSSVRNITIRSSSLSDPLEESSPI
AAIFDTENLEKISITEGIERGIVDSITGQRLLEAQACTGGIIHPTSGQKLSLQDAVSQGL
IDQDMATRLKPAQKAFIGFEGVKGKKKMSAAEAVKEKWLPYEAGQRFLEFQYLTGGLVDP
EVHGRISTEEAIRKGFIDGRAAQRLQDTSSYAKILTCPKTKLKISYKDAMNRSMVEDITG
LRLLEAASVSSKGLPSPYNMSSAPGSRSGSRSGSRSGSRSGSRSGSRSGSRRGSFDATGN
SSYSYSYSFSSSSIGH
Download sequence
Identical sequences M3XNC1
ENSMPUP00000000571 ENSMPUP00000000571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]