SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000584 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000584
Domain Number 1 Region: 381-744
Classification Level Classification E-value
Superfamily SIS domain 1.11e-104
Family double-SIS domain 0.000000491
Further Details:      
 
Domain Number 2 Region: 64-271,312-356
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.47e-54
Family Class II glutamine amidotransferases 0.0000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000584   Gene: ENSMPUG00000000590   Transcript: ENSMPUT00000000596
Sequence length 744
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896966.1:547299:594295:1 gene:ENSMPUG00000000590 transcript:ENSMPUT00000000596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSRQAGGGPSPAPPLAEGSTLKGPEAGRREPRPAECQARTEFRVSRTCRVSEPRRARAA
ATMCGIFAYMNYRVPRTRKEIFETLIKGLQRLEYRGYDSAGVAIDGHNNEVKERYIQLVK
KRGNVKALDEELYKQDSMDLKVEFETHFGIAHTRWATHGVPNAVNSHPQRSDKGNEFVVI
HNGIITNYKDLRKFLESKGYEFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQL
EGAFALVFKSIHYPGEAVATRRGSPLLIGVRSKYKLSTEQIPILYRTRNFENVKNICKTR
MKRLDSSTCLHAVGDKAVEFFFASDASAIIEHTNRVIFLEDDDIAAVADGKLSIHRVKRS
ASDDPSRAIQTLQMELQQIMKGNFSAFMQKEIFEQPESVFNTMRGRVNFETNTVLLGGLK
DHLKEIRRCRRLIVIGCGTSYHAAVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVC
FFISQSGETADTLLALRYCKDRRALTVGVTNTVGSSISRETDCGVHINAGPEIGVASTKA
YTSQFISLVMFGLMMSEDRISLQNRRREIICGLRSLPGLIKEVLSLDEKIHDLALELYTQ
RSLLVMGRGYNYATCLEGALKIKEITYMHSEGILAGELKHGPLALIDKQMPVIMVIMKDP
CFAKCQNALQQVTARQGRPIILCSRDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLS
FHLAVLRGYDVDFPRNLAKSVTVE
Download sequence
Identical sequences M3XND4
ENSMPUP00000000584 ENSMPUP00000000584 XP_004759043.2.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]