SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000590 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000590
Domain Number 1 Region: 64-489
Classification Level Classification E-value
Superfamily Ras GEF 4.05e-111
Family Ras GEF 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000590   Gene: ENSMPUG00000000596   Transcript: ENSMPUT00000000602
Sequence length 495
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896966.1:715250:747231:1 gene:ENSMPUG00000000596 transcript:ENSMPUT00000000602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPWAGTICELSKPCPKQPSLGVGAERTGMPRTLSTSDMVTPGSLGPSPTEPTDGEQIGQ
PLLDGAPSSASLDTLIQHLVPTTDYYPEKAYIFTFLLSSRLFIEPRELLARVCHLCIEQQ
QLDQPVLDKARVRKFGPKLLQLLAEWTETFPRDFQEESTIGHLKDVMGRIAPCDETYRKR
MQQLLQALHQKLAAQGQGPEDLLGADKPISYRTKPPASIHRELLGVCSDPYTLAQQLTHV
ELERLRHIGPEEFVQAFVNKDPLASTKPCFSDKTNNLEAYVKWFNRLCYLVATEICMPAK
KKQRAQVVEFFIDVARECFNIGNFNSLMAIISGMNMSPVSRLKKTWAKVKTAKFFILEHQ
MDPTGNFCNYRTALRGAAHRSLTAHSSREKIVIPFFSLLIKDIYFLNEGCANRLPNGHVN
FEKFLELAKQVGEFITWKQVECPFEQDPSITHYLHTAPIFSEDGLYLASYESESPENQTE
KERWKSLRSSILGKT
Download sequence
Identical sequences M3XNE0
XP_004759051.1.14098 ENSMPUP00000000590 ENSMPUP00000000590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]