SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000596 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000596
Domain Number 1 Region: 2-111
Classification Level Classification E-value
Superfamily PX domain 3.27e-28
Family PX domain 0.0011
Further Details:      
 
Domain Number 2 Region: 151-362
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000000107
Family IMD domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000596   Gene: ENSMPUG00000000602   Transcript: ENSMPUT00000000608
Sequence length 364
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896964.1:5517600:5537446:-1 gene:ENSMPUG00000000602 transcript:ENSMPUT00000000608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAYVAYKVTTQTSLPMFRSKQFAVKRRFSDFLGLYEKLSEKHSQNGFIVPPPPEKSLIG
MTKVKVGKEDSSSAEFLEKRRAALERYLQRIVNHPTMLQDPDVREFLEKEELPRAVGTQT
LSGAGLLKMFNKATDAVSKMTIKMNESDIWFEEKLQEVECEEQRLRKLHAVVETLVNHRK
ELALNTAQFAKSLAMLGSSEDNTALSRALSQLAEVEEKIEQLHQEQANNDFFLLAELLSD
YIRLLAIVRAAFDQRMKTWQRWQDAQATLQKKREAEARLLWANKPDKLQQAKDEILEWES
RVTQYERDFERISTVVRKEVIRFEKEKSKDFKNHVIKYLETLLSSQQQLAKYWEAFLPEA
KAIS
Download sequence
Identical sequences M3XNE6
ENSMPUP00000000596 ENSMPUP00000000596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]