SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000608 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000608
Domain Number 1 Region: 1-224
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.91e-55
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0053
Further Details:      
 
Domain Number 2 Region: 313-486
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000268
Family FAD/NAD-linked reductases, N-terminal and central domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000608   Gene: ENSMPUG00000000614   Transcript: ENSMPUT00000000620
Sequence length 533
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897209.1:129689:159044:-1 gene:ENSMPUG00000000614 transcript:ENSMPUT00000000620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKKRIAVIGGGVSGLSSIKCCVEEGLEPVCFERTDDIGGLWRFQENPEEGRASIYKSVI
INTSKEMMCFSDYPIPDHYPNFMHNSQVLEYFRMYAKEFDLLKYIRFKTTVCSVKKRPDF
STSGQWEVVTESEGKKEVNVFDGVMVCTGHHTNAHLPLESFPGIDKFKGQYFHSRDYKNP
DIFTGKRVIIIGIGNSGGDLAVEICHTAKQVFLSTRRGAWILNRVGDFGYPFDVLFSSRY
KYFLSKICGRSLVNSVLEKKLNQRFDHEMFGLKPKHRPLSQHPTMNDDLPNRIISGLVKV
KGNVTEFTETAAIFEDGSREDNIDAVIFATGYTFAFPFLEDSVQVVKNKISLYKKVFPPN
LEKPTLAIIGLIQPLGAIMPISEMQGRWVTQVFKGLKTLPSQSEMNAEIAKAQEEISKRY
VESQRHTIQGDYVDTMEELADLVGVRPNLLSLAFTDPKLAIQLFWGPCTPIHYRLQGPGK
WDGARKAILTTEDRIRKPMMTRVIESRNSMTSTITMARFMLAIVFFAIIMTYF
Download sequence
Identical sequences M3XNF8
XP_004779661.1.14098 XP_004779662.1.14098 ENSMPUP00000000608 ENSMPUP00000000608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]