SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000625 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000625
Domain Number 1 Region: 236-320
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-23
Family PDZ domain 0.0016
Further Details:      
 
Domain Number 2 Region: 2-94
Classification Level Classification E-value
Superfamily PDZ domain-like 1.04e-21
Family PDZ domain 0.0011
Further Details:      
 
Domain Number 3 Region: 127-217
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-21
Family PDZ domain 0.001
Further Details:      
 
Domain Number 4 Region: 354-459
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-21
Family PDZ domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000625   Gene: ENSMPUG00000000631   Transcript: ENSMPUT00000000637
Sequence length 521
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897209.1:935760:972878:-1 gene:ENSMPUG00000000631 transcript:ENSMPUT00000000637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTFHPRECELSKQEGQSYGFFLRIEKDTDGHLVRVVEKGSPAEKAGLQDGDRVLRING
VFVDKEEHMQVVDLVRKSGNSVTLLVLDGNSYEKAMKKQVDLKELSQSRKEPSLNDKKLP
SVVNQGAQTWTQPRLCYLVKEGNSYGFSLKTVQGKKGVYMTDITPQGVAMKAGVLAGDHL
IEVNGENVEDASHEEVVAKVKNSGSRVMFLLVDKETDKLHAEQKIKFKRETASLKLLPHQ
PRVVEMKKGSNGYGFYLRAGPEQKGQVIKDIDSGSPAEEAGLKNNDLLVAVNGQSVESLD
HDSVVEMIRKGGDQTSLLVVDKETDNMYRLAHFSPFLYYQSQELPNGSIKEAPAPMPDPT
PPEVSSPDTTEEARDHKPKLCWLVKGENGCGFHLNAIQGQPGSFIKEVQKGGPAELAGLE
DEDIIIEVNGVNVVDEPYEKVVESIQSSGKNVTFLVCGKKAYEYFQAKKIPIVSSMADPL
DAPTDSKEETPAEPEHDSHMAKERAYSTASHSSSNSEDTEM
Download sequence
Identical sequences M3XNH5
ENSMPUP00000000625 XP_004779688.1.14098 XP_004779689.1.14098 ENSMPUP00000000625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]