SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000646 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000646
Domain Number 1 Region: 123-506
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.25e-144
Family Myotubularin-like phosphatases 0.0000000258
Further Details:      
 
Domain Number 2 Region: 8-112
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-16
Family GRAM domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000646   Gene: ENSMPUG00000000652   Transcript: ENSMPUT00000000658
Sequence length 643
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897094.1:3586848:3612538:-1 gene:ENSMPUG00000000652 transcript:ENSMPUT00000000658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FVVYMFPKVEQVKLLDRFSTNNKSLTGTLYLTATHLLFIDSHQKETWILHHHIALVEKLA
LTTSGCPLVIQCKNFRIVHFIVPRERDCHDIYNSLLQLSKQAKYEDLYAFSYNPKQNDSK
RLQGWELIDLAEEYKRMGVPNSNWQLSDANREYKICETYPRELYVPRIASKPIIVGSSKF
RSKGRFPVLSYYHHNKEAAICRCSQPLSGFSARCLEDEHLLQAISKANPVNRYMYVMDTR
PKLNAMANRAAGKGYENEDNYSNIRFQFVGIENIHVMRSSLQKLLEVNGTKGLSVSDFYS
GLESSGWLRHIKAVMDAAIFLAKAIMVENASVLVHCSDGWDRTSQVCSLGSLLLDPYYRT
IKGFMVLIEKDWISFGHKFSERGARCGHLDGDPKEVSPVFTQFLECVWHLTEQFPQAFEF
NEEFLLQIHEHIHSCQFGNFLGNCQKEREELKLKEKTYSLWPFLLDDQKKYFNPLYSSKS
PKFSVLEPNTVSFNFKFWRNMYHQFDRTLHPRQSVFNIIMDMDEQNKQLEKDIKDLESLE
LLSLNFSIEVFEPSPSTKIKQCKKKQTDGILTKELLHSVHPESPTLKTSLCFKEQTLLPV
NHALRTIEGSNPADNRYREYAEEFSKSEPGVVSLEYDVARMTC
Download sequence
Identical sequences M3XNJ6
ENSMPUP00000000646 ENSMPUP00000000646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]