SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000668 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000668
Domain Number 1 Region: 6-80
Classification Level Classification E-value
Superfamily SH3-domain 5.12e-17
Family SH3-domain 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000000668
Domain Number - Region: 624-696
Classification Level Classification E-value
Superfamily STAT 0.0412
Family STAT 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000668   Gene: ENSMPUG00000000670   Transcript: ENSMPUT00000000680
Sequence length 835
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896938.1:9744673:9790768:-1 gene:ENSMPUG00000000670 transcript:ENSMPUT00000000680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKYKNLMARALYDNVPECAEELAFRKGDILTVIEQNTGGLEGWWLCSLHGRQGIVPGNRV
KLLIGPIQETPSGQDQPTSGLMHQSFGQQKLYQAPNPHGAPRDTIYQVPSSYQHQGIYQV
PTSHGTQEQDVYQVPPSVQRSIGGANGPHLSKKVVTPVRTGQGYVYEYPARYQKDIYDIP
PSHATQGVYDIPPSSVKGPVFSVPVGEIKPQGIYDIPPTKGVYAVPPSACRDEAGLREKE
YDFPPPVRQAARPDVRPEGVYDIPPTSTKPMGKDLHVKYSCDAAGTTDLATRRPQNVSLN
HPPSQLGQSLGPQNDAYDVPRGVQFLEPPAETSEKANPEEREGVYDVPLHSAPDTKGCQD
VVDGINRLSFSSTGSTRSNMSTSSTTSKESSLSTSPSPDKRLLLDPDTAIERLHRLQQSL
EMGVSSLMALVTTDWRCYGYMERHVNEIRASVDRVEVSVRDYLHFAKGATANASCLPELL
LQNKMKRELQRVEDSHQILSQTSHDLNECSWSLNILAVNKPQNKWDDLDRFVMVAKTVPD
DAKQLTTTINTNAEALFRPGPGGSHAKSGSESITNSTEYPHVASQVQLLLPPGDPKAQAL
TKPLPPSLGKDQPPDCSSSDSSERSWMDDYDYVHLQGKEEFERQQKELLEKENIIKQNKM
QLEHHQLSQFQLLEQEITKPVENDISKWKPSQSLPTTNSSVGTQDRQLLCFYYDQCETHY
ISLLNAIDALFSCVSLAQPPRIFVAHSKFVILSAHKLVFIGDTLTRQVAAQDIRNKVMNS
SNQLCEQLKAIVMATKMAALHYPSTTALQEMVHQVTDLSRNAQLFKHSLLEMATF
Download sequence
Identical sequences M3XNL8
ENSMPUP00000000668 ENSMPUP00000000668 XP_004753769.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]